KEGG   Pseudomonas aeruginosa LESB58: PLES_00341Help
Entry
PLES_00341        CDS       T00818                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00260  Glycine, serine and threonine metabolism
pag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01130  Biosynthesis of antibiotics
pag01230  Biosynthesis of amino acids
Module
pag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PLES_00341 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PLES_00341 (trpA)
Enzymes [BR:pag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PLES_00341 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAW24762
UniProt: B7V0S0
Position
complement(37074..37880)
Genome map
AA seq 268 aa AA seqDB search
MSRLQTRFAQLKQENRAALVTFVTAGDPDYASSLEILKGLPAAGADVIELGMPFTDPMAD
GPAIQLANIRALDGGQTLARTLQMVREFRSGESETPLVLMGYFNPIHHYGVERFIAEAKE
VGVDGLIVVDLPPEHNEDLCHPAQAAGLDFIRLTTPTTGDQRLPTVLEGSSGFVYYVSVA
GVTGANAATLEHVEEAVARLRRHTDLPIGIGFGIRSAEHAAAVARLADGVVVGSALIDRI
AKARDNAQAVKDVLALCGELAEGVRNAR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgcccagctcaagcaggaaaaccgcgccgccctggtg
accttcgtcaccgccggcgacccggactacgcgtcttccctggaaatcctcaaaggcctg
ccggcggccggagccgacgtgatcgaactgggcatgccgttcaccgatccgatggcggac
ggcccggccatccagttggccaacatccgcgccctcgacggcggccagaccctggccagg
acgttgcagatggtccgcgaattccgcagcggcgagagcgagacgcccctggtgctgatg
ggctacttcaacccgatccaccactacggcgtcgaacgcttcatcgccgaggcgaaggag
gtgggggtggacggcctgatcgtggtcgacctgccgccggagcacaacgaagacctctgc
cacccggcccaggccgccggcctcgacttcatccgcctgaccaccccgaccaccggcgac
cagcgcctgccgacggtgctcgaaggcagttccgggttcgtctactacgtgtcggtggcc
ggcgtcaccggcgccaacgcggcgaccctggaacacgtcgaggaagcggtggcgcgcctg
cgccggcataccgacctgccgatcggtatcggcttcggcatccgcagcgccgaacacgcc
gccgcggtcgcgcggttggccgacggcgtggtggtcggctcggcgctgatcgaccggatc
gccaaggcccgcgacaatgcccaggcggtcaaggatgtcctcgccctgtgcggcgagctg
gccgaaggcgtgcgcaacgcacgctga

DBGET integrated database retrieval system