KEGG   Pseudomonas aeruginosa LESB58: PLES_02841Help
Entry
PLES_02841        CDS       T00818                                 

Gene name
gpuA
Definition
3-guanidinopropionase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
Enzymes [BR:pag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     PLES_02841 (gpuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316584..317540
Genome map
AA seq 318 aa AA seqDB search
MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPRE
VRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPL
SVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDP
LRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGDGPTYVSFD
VDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGA
TMMFELLCLLAESAARSA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaccatccgcagcccctcgacgccgccgagattccacgcttcgccggcatc
ccgaccttcatgcgcctgccggcgttcaccgacccggcggcgctgcaggtcggcctgatc
ggcgtgccctgggatggcggcaccaccaaccgcgccggtgcccgccatggtccgcgcgag
gtgcgcaacctgtccagcctgatgcgcaaggtgcatcacgtcagccgcatcgcgccctac
gacctggtgcgggtcggcgacctcggtgatgcgccggtgaatcccatcgacctgctcgat
tcgctgcgccgcatcgaaggcttctatcgccaggtccatgccgccggtaccctgccgctg
tcggtcggtggcgaccacctggtgaccctgccgatctttcgcgccctgggtcgcgagcgg
ccgctgggcatggtgcatttcgatgcgcattccgataccaacgaccgctacttcggcgac
aacccctacacccacggcacgccattccgccgggccatcgaggaaggtctgctcgacccg
ctgcgcacggtgcagatcggcattcgcggctcggtgtattcgccggacgacgacgctttc
gcccgcgagtgcggcatccgcgtgatccacatggaagagttcgtcgaactgggcgtcgag
gcgaccctggccgaagctcggcgggtggtgggcgacgggccgacctatgtgagtttcgac
gtcgacgtgctcgacccggccttcgcgcctggcaccggcaccccggagatcggcggcatg
accagcctccaggcccagcaactggtccgcggcctgcgcgggctggacctggtcggcgcc
gacgtggtggaagtctcgccgccgttcgatgtcggcggcgccacggcgctggtgggggcg
accatgatgttcgagctgctctgcctgcttgccgagtcggccgcgcgaagcgcctga

DBGET integrated database retrieval system