KEGG   Pseudomonas aeruginosa LESB58: PLES_05801Help
Entry
PLES_05801        CDS       T00818                                 

Definition
putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PLES_05801
Enzymes [BR:pag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PLES_05801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632546..633088
Genome map
AA seq 180 aa AA seqDB search
MSLIPVYLGLGSNVERERHLHAGLDALAGFLHDLRCSPVFESEPVGIKSGPFFNLVVSAR
TDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLFYGDLVGDFDGLVLPRAEVLKNAF
VLWPLSELAPNLEHPVARQPLGDLWREARIQQKLWPAPFEWRGQALTPEALLQAFPRSSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgatcccggtctacctcggcctcggcagcaatgtcgagcgtgagcgccacctg
catgccggcctcgatgcgctggccggtttccttcatgacctgcgttgctcgccggtgttc
gagagcgagccggtgggtatcaagagcgggccgttcttcaacctggtggtgtctgcccgc
accgatctgccgctggccgaactgagcctgcgactcaagcacatcgaggccgacaatggc
cgctatgcgccagagcgcaaggggctgccgctggatatcgacgtgctgttctacggcgac
ctggtgggcgatttcgatggcctggtgctgccgcgcgccgaagtgctgaagaacgctttc
gtgctctggcccttgtccgagctggcgccgaacctggagcatccggtcgcccgccagccg
ctgggcgatctctggcgcgaggcgaggatccagcagaagctctggccggcgccattcgaa
tggcgtggccaggcgttgactcccgaagcgctgcttcaggcctttccgcgttcttccttg
tag

DBGET integrated database retrieval system