KEGG   Pseudomonas aeruginosa LESB58: PLES_06301Help
Entry
PLES_06301        CDS       T00818                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01130  Biosynthesis of antibiotics
pag01230  Biosynthesis of amino acids
Module
pag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PLES_06301 (trpC)
Enzymes [BR:pag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PLES_06301 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAW25357
UniProt: B7V609
Position
682386..683222
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIA
EIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPV
IRKDFMIDPYQIVEARAIGADCILLIVSALDDVLMAELAATAKSVGLDVLVEVHDGTELE
RALKTLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSE
VYAFLVGEAFMRADDPGLELKRLFFQERGGVVLGADPD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgccgacggttctgcagaagatcctcgcccgcaaggccgaggaggtcgccgag
cgccgtgcgcgcgtcaacctggccgaggtcgagcggctggcgcgtagcgccgatgcgccg
cgcggcttcgccaatgccctgctggagcgggccaagcgcaaggagccggcagtgatcgcc
gagatcaagaaggcatcgccgagcaagggcgtgctgcgcgaacacttcgtcccggcggag
atagcccgcagctacgaggcgggtggcgcggcgtgcctgtcggtgctcaccgacgtggac
ttcttccagggcgccgatgcctatctgaaggaagcgcgggccgcctgtgcgctgccggtg
atccgcaaggacttcatgatcgatccgtaccagatcgtcgaggcgcgggcgatcggtgcc
gactgcatcctgctgatcgtctcggcgctggacgacgtgctgatggccgaactggcggcg
actgccaagtcggtcggtctcgacgtactggtcgaagtgcatgacggcaccgagctggaa
cgtgcgctgaagaccctggacacgccgttggtgggcatcaacaaccgcaacctgcacacc
ttcgaggtgagcctggaaaccaccctcgacctgttgccggaaattccccgcgaccgcctg
gtggtcaccgagagcggtattctcaaccgggccgacgtggagctgatggaagtcagcgag
gtctacgccttcctggttggcgaggcgttcatgcgggccgacgatcctggcctggagttg
aagcgcctgttcttccaggagcgtggcggcgtggtgctgggcgccgatcctgactga

DBGET integrated database retrieval system