KEGG   Pseudomonas aeruginosa LESB58: PLES_06631Help
Entry
PLES_06631        CDS       T00818                                 

Gene name
tufA
Definition
elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
pag  Pseudomonas aeruginosa LESB58
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724081..725274
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALMALE
GKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGII
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccatcggtcac
gttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctccgacacctgg
ggtggttccgctcgtgctttcgatcagatcgacaacgcgccggaagaaaaggcccgcggt
atcaccatcaacacctcgcacgttgaatacgattccgctgttcgtcactacgctcacgtt
gactgccccggtcacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgccaggtaggcgttccctacatcgtcgtgttcctgaacaaggctgacatg
gtcgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatggcgctggaa
ggcaaggatgacaacggcatcggcgtaagcgccgtgcagaagctggtagagaccctggac
tcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgcggcatcatc
aaggtccaggaagaagtggaaatcgtcggcatcaaggcgaccaccaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgttggtatc
ctgctgcgtggcaccaagcgtgaagacgtagagcgtggccaggtactggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccaccgac
gtgaccggtaactgcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcgatc
cgcgaaggcggccgtaccgttggcgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system