KEGG   Pseudomonas aeruginosa LESB58: PLES_06631Help
Entry
PLES_06631        CDS       T00818                                 

Gene name
tufA
Definition
elongation factor Tu
Orthology
K02358  
elongation factor Tu
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
Mitochondrial biogenesis [BR:pag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PLES_06631 (tufA)
Exosome [BR:pag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PLES_06631 (tufA)
  Exosomal proteins of breast cancer cells
   PLES_06631 (tufA)
  Exosomal proteins of colorectal cancer cells
   PLES_06631 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724081..725274
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALMALE
GKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGII
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaggaaaaattcgaacgtaacaaaccgcacgtcaacgtcggcaccatcggtcac
gttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctccgacacctgg
ggtggttccgctcgtgctttcgatcagatcgacaacgcgccggaagaaaaggcccgcggt
atcaccatcaacacctcgcacgttgaatacgattccgctgttcgtcactacgctcacgtt
gactgccccggtcacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgccaggtaggcgttccctacatcgtcgtgttcctgaacaaggctgacatg
gtcgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatggcgctggaa
ggcaaggatgacaacggcatcggcgtaagcgccgtgcagaagctggtagagaccctggac
tcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgcggcatcatc
aaggtccaggaagaagtggaaatcgtcggcatcaaggcgaccaccaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgttggtatc
ctgctgcgtggcaccaagcgtgaagacgtagagcgtggccaggtactggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacaccccgttcttcaagggctaccgtccgcagttctacttccgtaccaccgac
gtgaccggtaactgcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcgatc
cgcgaaggcggccgtaccgttggcgccggcgtggttgccaagatcatcgagtaa

DBGET integrated database retrieval system