KEGG   Pseudomonas aeruginosa LESB58: PLES_07751Help
Entry
PLES_07751        CDS       T00818                                 

Definition
(GenBank) probable hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00010  Glycolysis / Gluconeogenesis
pag00020  Citrate cycle (TCA cycle)
pag00620  Pyruvate metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01200  Carbon metabolism
Module
pag_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_07751
   00020 Citrate cycle (TCA cycle)
    PLES_07751
   00620 Pyruvate metabolism
    PLES_07751
Enzymes [BR:pag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PLES_07751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_5 Esterase Ndr GCV_H Abhydrolase_3 PGAP1 AXE1 PAF-AH_p_II Lipase_3
Motif
Other DBs
NCBI-ProteinID: CAW25502
Position
complement(846406..847518)
Genome map
AA seq 370 aa AA seqDB search
MSRIHTLTMPKWGLSMTEGRVDAWLKEEGAHIEKGDEVLDVETDKISSSVEAPFSGVLRR
KVAREDETLAVGALLGVVVEGEASDEEIDALVQRFQAEFVPADEDAGDSGPAPRKVELDG
RLLRYFDRGEGDPALLLIHGFGGDLNNWLFNHEALAAERRVIALDLPGHGESGKALVRGD
LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIGSAGLGEEING
DYLRGFVEAANRNALKPQLVQLFSDPALVTRQMLEDMLRYKRLEGVDAALRQLLDNLFAD
GRQRNDLRAVASEGRQPVLAIWGSDDAIIPARHAEGLPAQVEIIPGQAHMVQMEAAEQVN
RLLLDFLRQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatccatacactgaccatgcccaagtggggcctgtcgatgaccgagggtcgg
gtggacgcctggctcaaggaagagggcgcgcatatcgagaaaggcgacgaggtgctcgac
gtggagaccgacaagatctccagcagcgtcgaggcgcccttctcgggcgtgctgcggcgc
aaggtggcgcgcgaggacgagaccctggcggtcggcgcgctgctcggcgtggtggtcgag
ggcgaggcgagcgacgaggagatcgacgcactggtgcaacgcttccaggccgaattcgta
cccgccgacgaggacgctggggatagcggaccggcaccgcggaaagtcgagctggacggg
cgcctcctgcgctatttcgaccgcggcgagggcgatccggcgctactgctgatccacggt
ttcggtggcgacctgaacaactggttgttcaaccacgaggcgctggccgccgagcggcgg
gtgatcgctctagacctgccgggccacggcgagtccggcaaggccctggtgcgcggcgac
ctcgatgaactcagcggcagcgtgctggccctgctcgaccacctcgacctggaacaggta
cacctggccggtcactccatggggggagcggtggcgctgaactgcgcgcgcctggcgccg
cagcgggtgctgtcgctgagcctgatcggcagcgccggcctcggcgaggagatcaacggc
gactacctgcgcggcttcgtcgaggcggccaaccgcaacgcgttgaagccgcaactggtg
cagttgttctccgaccccgcgctggtcacccggcagatgctcgaggacatgctccgctac
aagcgcctggaaggcgtcgatgcggccctgcgccagttgctggacaacctgttcgccgac
ggtcgccagcgcaacgacctgcgtgccgtggcgagcgagggccgccagccggtcctggcg
atctggggcagcgatgacgcgatcatcccggcgcggcatgccgagggcctgccagcccag
gtggagatcattcccggacaggcgcacatggtgcagatggaagccgccgagcaggtcaac
cgcctgctgctcgacttcctccgccagcattga

DBGET integrated database retrieval system