KEGG   Pseudomonas aeruginosa LESB58: PLES_12451Help
Entry
PLES_12451        CDS       T00818                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PLES_12451 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PLES_12451 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PLES_12451 (thrC)
Enzymes [BR:pag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PLES_12451 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1349315..1350724
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWVGLPYHELAFRVMR
PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPHNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGKLSVEDQRWTEARKLFDS
LAVSDEQTCETIAEVYRSCGELLDPHTAIGVRAARECRRSLSVPMVTLGTAHPVKFPEAV
EKAGIGQAPALPAHLADLFEREERCTVLPNELAKVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagcacccgcggccaagcgcccgccctgaacttcgaagatgtcctcctc
gccggcctggccagcgacggcggcctctacgtcccggaaaacctgccacgcttcaccctc
gaggagatcgcctcctgggtcggcctgccctaccacgagctggccttccgggtgatgcgc
ccgttcgtcgccggcagcatcgccgatgccgacttcaagaagatcctcgaggaaacctat
ggcgtcttcgcccatgacgcagtggcgccgctgcgccagttgaacggcaacgaatgggtg
ctggagctgttccacggcccgaccctggccttcaaggacttcgccctgcaactgctcggc
cgcctgctcgaccatgtgctggccaagcgcggcgagcgcgtggtgatcatgggggccacc
tccggcgataccggctccgcggccatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcatgcacccgcacaaccgcgtgtccgaggtgcagcgccggcagatgaccaccatc
ctcggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaagggtacccgcctggtagcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgccgcgctgcag
ctcggcgcgccgcatcgctcggtggcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggcctgccggtcagccagctgatcgtcgcgacc
aaccgcaacgacatcctgcaccgcttcatgagcggtaatcgctacgacaaggacaccctg
catccctcgctgtcgccgtcgatggatatcatggtctcgtccaacttcgaacgcctgctg
ttcgacctgcacggccgcaacggcaaggccgtcgccgaactgctggatgccttcaaggcc
agcggcaagctgtcggtggaagaccagcgctggaccgaggcgcgcaagctgttcgactcc
ctggcggtcagcgacgagcagacctgcgagaccatcgccgaggtataccgctcctgtggc
gagttgctcgacccgcacaccgccattggcgtgcgtgccgcccgcgaatgccggcgcagc
ctgagcgtgccgatggtgaccctgggcactgcgcatccggtcaagttccccgaagcggtg
gagaaggccggcatcggccaggcgccggcgctgcctgcgcacctcgccgacctgttcgag
cgcgaggagcgctgcaccgtattgccgaacgagctggccaaggtacaggccttcgtcagc
cagcacggcaatcgcggcaagccgctctga

DBGET integrated database retrieval system