KEGG   Pseudomonas aeruginosa LESB58: PLES_14111Help
Entry
PLES_14111        CDS       T00818                                 

Gene name
pcm
Definition
(GenBank) L-isoaspartate protein carboxylmethyltransferase type II
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
Enzymes [BR:pag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PLES_14111 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD NodS Methyltransf_11 Methyltransf_24 Methyltransf_32 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: CAW26139
UniProt: B7V8C3
Position
1519712..1520347
Genome map
AA seq 211 aa AA seqDB search
MTSQRTRERLIQRLYEEGLSNAHVLEVIRRTPRHLFVDEALSHRAYEDTALPIGHNQTIS
QPFMVARMTELLLAAGPLDKVMEIGTGSGYQTAVLAQLVERVFSVERIQALQDKAKERLA
ELNLRNVVFRWGDGWEGWSALAPYNGIIVTAAATEVPQSLLDQLAPGGRLVIPVGGGEVQ
QLMLIVRTEDGFSRQVLDSVRFVPLLNGPIA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccagcgtacccgagagcgcctgatccagcgcctgtacgaagaaggcctgtcc
aacgcccacgtgctcgaggtgatccgccgcacgccgcgtcatctgttcgtcgacgaggcg
ctctcgcatcgcgcctacgaagacaccgccctgccgatcggccacaaccagaccatttcc
cagccattcatggtggcgcggatgaccgagttgctgctggcggccggcccgctggacaag
gtcatggagatcggtaccgggtccggctaccagaccgcggtgctggcgcaactggtcgag
cgggtcttctctgtcgagcggatccaggcgttgcaggacaaggccaaggagcgtcttgcg
gagctaaacctgcgtaatgttgtctttcgttggggcgatggctgggagggctggtcggcg
ttggctccctacaatggaatcatcgtcaccgcggcggccacggaagtcccgcagtcgttg
ctggaccagttggccccggggggccgtctggtgatcccggtcggtggcggcgaggtccag
caactgatgctgatcgtccgcaccgaggacgggttcagccgccaggtactcgactcggta
cgtttcgtcccgctgctcaacggcccgatcgcctga

DBGET integrated database retrieval system