KEGG   Pseudomonas aeruginosa LESB58: PLES_16231Help
Entry
PLES_16231        CDS       T00818                                 

Gene name
folE1
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PLES_16231 (folE1)
Enzymes [BR:pag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PLES_16231 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1748430..1748990)
Genome map
AA seq 186 aa AA seqDB search
MNPALSQHYREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNGALFASDN
DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLT
RQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcactttcccagcattaccgggagatcctcgtcggtctcggcgaagacccg
cagcgcgaaggcctgctcgacaccccgaagcgcgcggccaaggccatgcagtacctctgc
cacggctatggccagaccctggaggaaatcgtcaacggcgcgctgttcgcctcggacaac
gatgaaatggtcatcgtccgcgacatcgagctgtactccctgtgcgaacaccacctcctg
cccttcatcggcaaggctcatgtggcgtacattcccaccggcaaggtactcggcctgtcg
aaggtggcgcggatcgtcgacatgttcgcccgccgcctgcagatccaggagaacctcacc
cggcagatcgccgaggcggtccgccaggtgaccagcgccgccggcgtggcggtagtgatc
gaggcccagcacatgtgcatgatgatgcgcggggtggagaagcagaactcgcagatgttc
acctcggtgatgctcggcgcgttccgcgactcgaacaccacccgccaggaatttctgcaa
ttgatcggaaggagcaagtga

DBGET integrated database retrieval system