KEGG   Pseudomonas aeruginosa LESB58: PLES_18751Help
Entry
PLES_18751        CDS       T00818                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PLES_18751 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_18751 (glk)
   00052 Galactose metabolism
    PLES_18751 (glk)
   00500 Starch and sucrose metabolism
    PLES_18751 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PLES_18751 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PLES_18751 (glk)
   00524 Butirosin and neomycin biosynthesis
    PLES_18751 (glk)
Enzymes [BR:pag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PLES_18751 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017457..2018452
Genome map
AA seq 331 aa AA seqDB search
MNNDNKRSAGGLGLVGDIGGTNARFALWRGQRLESIEVLACADYPRPELAVRDYLARIGE
SVANIDSVCLACAGPVGAADFRFTNNHWVINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRAGSAQADRARLIIGPGTGLGVGSLLPLGGGRWEVLPCEGGHVDLPVTSPRD
FALWQGLQARYGHVSAERALSGNGLLALYEISCALDGVAVRASSAAEVGALAMAGDAQAD
AVLEHFFLWLARVAGNAVLTVGALGGVYITGGIVPRFLERFIASGFAEAFASRGKTSGAY
LQDVPVWVMTAEHPGLLGAGVALQQALDAEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaacaagagaagcgccggcggcctcggcctggtcggcgatatcggcggc
accaatgcgcgtttcgcgctctggcgcgggcagcgcctggaatccatcgaggtgctcgcc
tgcgccgactacccgcggcctgaactggccgtgcgcgactacctggcgcggatcggcgaa
tcggtggcgaacatcgactcggtctgcctggcctgcgccggtccggtcggggcggccgat
ttccgtttcaccaacaaccactgggtgatcaatcgtgccgcgttccgcgaggagctgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggcta
ggtgcggacgagctggtgcaggtccgcgccggcagtgcccaggcggatcgcgcccggctg
atcatcggtcccggcaccggccttggcgtcggcagcctgctgccgctgggcgggggacgt
tgggaagtgctgccctgcgagggcgggcacgtcgacctgccggtcacttcgccgcgcgac
ttcgcgctctggcagggcctgcaggcgcgctacggacatgtctccgccgagcgcgcactg
tccggcaacggcctgctcgccctctatgaaatcagctgtgccctggacggggtcgccgta
cgcgcgagcagtgcggcggaagtcggtgccctggccatggccggcgacgcccaggcggac
gccgtgctggagcacttcttcctgtggctggcgcgggtcgccggcaacgcggtgctcacc
gtcggcgcgctcggtggcgtctacattaccggcggcatcgtcccgcgtttcctcgagcgt
ttcatcgccagcggcttcgccgaggccttcgccagccgtggcaagactagcggcgcttac
ctgcaggacgtaccggtgtgggtcatgaccgccgaacatccgggcctgctcggcgccggg
gtcgccctgcagcaggccctggacgccgagggctga

DBGET integrated database retrieval system