KEGG   Pseudomonas aeruginosa LESB58: PLES_21211Help
Entry
PLES_21211        CDS       T00818                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PLES_21211
Enzymes [BR:pag01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PLES_21211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2296232..2297248
Genome map
AA seq 338 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVRLDTQPPPAERAE
IIRRRLAFDADPQAFVERWEGQQDTLRRRCAEARRRLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALLHRRRQSNPPSSAANPPPPPAAA
PVALPERTGDGEGQWGELPARPVAMGTARELPRWPKKP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattaccccctgtccgccgtggtcgccgccgacgaactgaagctg
gcgctgtgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccctggcgcggggcgtcgccgaactgctgccggcgggcgagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagcctcgacctggacgcc
gccctcggcgaaggtcgcgcgcggttttccccaggcgtgctggccaaggccgacggcggc
gtgctctacgtcgacgaagtgaacctgctgccggaccacctggtggacttgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgatggcatttcccaccggcatccggcg
cgtttcgtgctgatcggcacgatgaacccggaagagggcgaactgcgcccgcaactgctc
gaccgtttcggcctcaacgtgcgtctcgatacccagccgccgccggccgagcgggcagag
atcatccgtcgccggctggccttcgatgccgacccgcaggccttcgtcgaacgctgggaa
ggccagcaggacaccctgcgccgccgttgcgccgaggcgcgccggcggctggcgcggatt
cccctggacgatgcggcgctggacagcatcgctcgacgctgcttcgaggcggctgtcgat
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagcggatcgaggcggaggacatcgatgcggtggaacatttcgccctgctgcatcgc
cgtcgccagtcgaacccgccatcatcggcggccaatccaccgccaccgcccgcggcggcc
cctgtcgcgctcccggagcgcaccggcgacggcgaagggcagtggggcgaattgccggct
cggccggtggccatggggaccgcccgcgagctgccgcgctggccaaaaaagccctga

DBGET integrated database retrieval system