KEGG   Pseudomonas aeruginosa LESB58: PLES_22391Help
Entry
PLES_22391        CDS       T00818                                 

Definition
(GenBank) probable glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00480  Glutathione metabolism
pag00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PLES_22391
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PLES_22391
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PLES_22391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA DUF4174
Motif
Other DBs
NCBI-ProteinID: CAW26966
Position
2414705..2415190
Genome map
AA seq 161 aa AA seqDB search
MSDSLLSIPCTTIKGEQKTLADFGGKALLVVNTASKCGFTPQYQGLEALWEKYRERGLVV
LGFPCNQFGKQEPGDEGEISQFCELNYGVSFPLFRKIEVNGAGAHPLFVSLKKRAPGLLG
SQGIKWNFTKFLIGRDGQVVKRYAPTTKPEELSSAIEALLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgctgctgagcattccctgcaccaccatcaagggcgaacagaagaccctg
gccgacttcggcggcaaggcgctgctggtggtgaacaccgccagcaagtgcggcttcacc
ccgcagtaccaggggctggaggccttgtgggaaaaataccgtgagcgcggactggtggtg
ctcgggttcccctgcaaccagttcggcaagcaggaaccgggcgacgagggcgagatttcg
cagttctgcgaactgaactacggggtgagcttcccgctgttcaggaagatcgaggtcaac
ggcgccggcgcccacccgttgttcgtcagcctgaagaagcgcgcgccgggcctgctcggc
agccagggcatcaagtggaacttcaccaagttcctgatcggccgcgatggccaggtggtg
aagcgctatgcgccgaccaccaagccggaggagctgagctcggcgatcgaggcgctgctt
gaatga

DBGET integrated database retrieval system