KEGG   Pseudomonas aeruginosa LESB58: PLES_22391Help
Entry
PLES_22391        CDS       T00818                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pag00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pag00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2414705..2415190
Genome map
AA seq 161 aa AA seqDB search
MSDSLLSIPCTTIKGEQKTLADFGGKALLVVNTASKCGFTPQYQGLEALWEKYRERGLVV
LGFPCNQFGKQEPGDEGEISQFCELNYGVSFPLFRKIEVNGAGAHPLFVSLKKRAPGLLG
SQGIKWNFTKFLIGRDGQVVKRYAPTTKPEELSSAIEALLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgctgctgagcattccctgcaccaccatcaagggcgaacagaagaccctg
gccgacttcggcggcaaggcgctgctggtggtgaacaccgccagcaagtgcggcttcacc
ccgcagtaccaggggctggaggccttgtgggaaaaataccgtgagcgcggactggtggtg
ctcgggttcccctgcaaccagttcggcaagcaggaaccgggcgacgagggcgagatttcg
cagttctgcgaactgaactacggggtgagcttcccgctgttcaggaagatcgaggtcaac
ggcgccggcgcccacccgttgttcgtcagcctgaagaagcgcgcgccgggcctgctcggc
agccagggcatcaagtggaacttcaccaagttcctgatcggccgcgatggccaggtggtg
aagcgctatgcgccgaccaccaagccggaggagctgagctcggcgatcgaggcgctgctt
gaatga

DBGET integrated database retrieval system