KEGG   Pseudomonas aeruginosa LESB58: PLES_24711Help
Entry
PLES_24711        CDS       T00818                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00630  Glyoxylate and dicarboxylate metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PLES_24711 (aceA)
Enzymes [BR:pag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PLES_24711 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAW27197
Position
complement(2658845..2660440)
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKAVAALKEKNGSSWSAINPEYAARMRIQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTGLDAARAAGDKAKEAELLAQIDNFETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHIDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRNKLMSVEYD
DTELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcagaacgagatcaaggcagttgccgcgctgaaagagaagaacggcagc
agctggagcgcgatcaaccccgagtacgcagctcgcatgcgtatccagaaccgcttcaag
accggcctggatatcgccaagtacaccgcggccatcatgcgcaaggacatggccgaatac
gatgcggactcctccgtctacacccagtcgctgggttgctggcacggcttcatcgggcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggttggatggtcgccgcgctgcgctccgacttcggcccgctgccggaccagtccatg
cacgagaaaaccgcggtttccggcctgatcgaagagctgtacaccttcctgcgccaggct
gacgcccgcgagctggacctgctgttcaccggcctggacgctgcccgcgccgctggcgac
aaggccaaggaagccgagctgctggcccagatcgacaacttcgaaacccacgtggtgccg
atcatcgccgacatcgacgccggcttcggcaacgccgaggcgacctacctgctggccaag
aagatgatcgaagccggcgcctgctgcatccagatcgagaaccaggtgtccgacgagaag
cagtgcggccaccaggacggcaaggtcaccgttccgcacatcgacttcctcgccaagatc
aatgccgtacgctacgccttcctcgagctgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggcgccggcctgaccaagcagatcgccgtgaccaacgagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaaatctccgaggccgagctgggc
aacggcgacgtcgtgatcaagcgcgaaggcaagctgctgcgtccgaagcgcctggcttcc
aacctgttccagttccgcaagggcaccggcgaagatcgctgcgtcctggactgcatcacc
tcgctgcagaacggcgccgacctgctctggatcgaaaccgagaagccgcacgtcggccag
atcaaggcaatggtcgatcgcatccgcgaagtgattccgaacgccaagctggtctacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcaacaagctgatgagcgtcgagtacgac
gacaccgagctggccaaggtcgccgacgagaagatccgcaccttccagcgcgatggctcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgacgaaggcatgctggcctacgtgaag
ggcgtgcagcgccaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggcg
ggctccgacatcggcgacaaccataaagagtacttcgcaggcgaagccgctctgaaggcc
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system