KEGG   Pseudomonas aeruginosa LESB58: PLES_31631Help
Entry
PLES_31631        CDS       T00818                                 

Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PLES_31631
Enzymes [BR:pag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PLES_31631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3485909..3487963
Genome map
AA seq 684 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDANGRPQRVDPEVQRGLLEALGYPAQSPQQIEQSLAALAR
LREDSANLGLLVGECGQPLEQALGPAGTPGELVYEDGTRIALRLDAEGRLPAQARSGYAQ
LSLEQREWAVAMAPPSCPSLASLAPGRSRRWGLAAQVYALRRPGDGGLGDSAALEDLLRS
AARHGADALAISPLHALAEANGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIRRAG
LAAEMARLESLELIDWTAAADLRMRLLRQLHRDFTERASPLRHDLAEFRREAGEALLHHC
RFETLQAHLGAGPDWRRWPEPLRRPGEPAVAAFCADHAEEVDFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGADGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLRANLAWPGGLRIDHVMGLQRLWLIPRGQPPHAGAYLRYPQRELLR
LLALEASRASALVIGEDLGTVPEGLREELARRQVLGTRVLLFERRGERFVPPAQWPADAM
ATTSTHDLPSLSGWWRGQDIHWRGRAGHRSAEECAADLELRAEERRALAASLEPPVDPDP
AAEVPLDACIGYVGATPAPLVLLPLEDALGSLEQPNLPGPGDAHPNWRRRWPENAAQMLG
TPQVDRRLRLLERSRRDAEEAAHD
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gacgccaacggacggccgcagcgggtcgacccggaggtccagcgcggcctgctggaagca
ctcggctatccggcgcagagtccgcaacagatcgaacagagcctggccgcgctggcccgg
ctgcgcgaggacagcgccaacctcggactgctggtcggcgaatgcggccagccgctggag
caagcgctcggccccgccggcaccccgggcgagctggtctacgaggacggcacgcggatc
gccctgcgcctggacgccgaaggccgcctgccggcgcaggcccgcagcggctatgcgcag
ctgtcgctggagcagcgggaatgggcggtggcgatggcgccgccgagctgcccgtccctg
gccagcctcgccccgggtcgctcgcgtcgctggggtctggccgcccaggtctatgccctg
cgccgccccggcgacggcggcctgggcgacagcgccgccctcgaggacctgctgcgcagc
gccgcgcggcatggcgccgacgcgctggcgatcagcccgctgcacgccctggccgaggcc
aacggacatgcctacagcccctactcgccgtccagccggctgttcttcaatgtcctgcac
gccgcgccggcgaccattctcggcgcggcggcggtggaacaggcgatccgtcgcgccggc
ctggccgcggagatggcccgcctggagagcctggagctgatcgactggacagcggcggcg
gacctgcgcatgcgcctgctgcgccagctccaccgcgacttcaccgagcgcgccagtccc
ttgcgccacgacctcgccgaattccgccgcgaagccggcgaggccctgctgcaccactgc
cgcttcgagaccctgcaggcgcacctgggcgccggccccgactggagacgctggccggag
ccgctgcgccgccccggcgagccggcggtggccgcgttctgcgccgatcacgccgaggaa
gtggacttccgtgccttcggccagtggctgacccaacgttgcctgcaacatgcccagcgc
caggcgcgcgaggccgggatggccatcggtctggtcgccgacctggcggtgggcgccgat
ggcggcggcagccaggcctggtcgcggcaggaagagctgctcgccgaagtgaatgtcggc
gcgccgccggacatcctcaaccagtccggacaggactggggcgtttccgcgttcaatccc
gaaggcctgcgccgccacggctaccgggcattccgcgagatgctgcgggccaacctggcc
tggcccggagggctacgcatcgaccatgtgatgggcctgcaacgtctctggctgatcccg
cgcggccagccgccccacgccggcgcctacctgcgctacccgcaacgcgagctgctgcgc
ctgctggcgctggaggccagtcgcgcctcggcgctggtcatcggcgaggacctcggcacc
gttcccgaaggcctgcgcgaggaactggcacgccgccaagtgctgggtacccgcgtgctg
ctcttcgagcggcgcggcgaacgcttcgtgcccccggcgcaatggccggcggacgccatg
gccaccaccagcacccacgacctgccgagcctgtccggctggtggcggggccaggacatc
cactggcgcggccgcgccggacaccgcagcgccgaggaatgcgcggccgacctggaactg
cgcgccgaggagcgccgggcgctggccgccagcctcgaaccgccggtcgatcccgacccc
gccgccgaagtgccgctggacgcctgcatcggctatgtcggagcgacccccgcgccgttg
gtgctactgcccctggaggacgccctgggcagcctggagcagccgaacctgcccggcccc
ggcgacgcccacccgaactggcggcggcgctggccggaaaacgccgcgcagatgctcgga
acgccgcaggtcgaccggcgcctgcgcctgctcgaacgcagccgccgggatgccgaggag
gccgcccatgattga

DBGET integrated database retrieval system