KEGG   Pseudomonas aeruginosa LESB58: PLES_35811Help
Entry
PLES_35811        CDS       T00818                                 

Definition
(GenBank) probable enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00071  Fatty acid degradation
pag00280  Valine, leucine and isoleucine degradation
pag00281  Geraniol degradation
pag00310  Lysine degradation
pag00360  Phenylalanine metabolism
pag00362  Benzoate degradation
pag00380  Tryptophan metabolism
pag00410  beta-Alanine metabolism
pag00627  Aminobenzoate degradation
pag00640  Propanoate metabolism
pag00650  Butanoate metabolism
pag00903  Limonene and pinene degradation
pag00930  Caprolactam degradation
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01212  Fatty acid metabolism
Module
pag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PLES_35811
   00650 Butanoate metabolism
    PLES_35811
  Lipid metabolism
   00071 Fatty acid degradation
    PLES_35811
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PLES_35811
   00310 Lysine degradation
    PLES_35811
   00360 Phenylalanine metabolism
    PLES_35811
   00380 Tryptophan metabolism
    PLES_35811
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PLES_35811
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PLES_35811
   00281 Geraniol degradation
    PLES_35811
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PLES_35811
   00627 Aminobenzoate degradation
    PLES_35811
   00930 Caprolactam degradation
    PLES_35811
Enzymes [BR:pag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PLES_35811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAW28308
Position
3978072..3978761
Genome map
AA seq 229 aa AA seqDB search
MSELISYQFEDGIATLTLNNGKVNAISPAVIDAFNQALDQALQDKAVVIVTGQPGILSGG
YDLKVMTSGPENAVNLVAAGSTLARRLLSHPYPVIVACPGHAVAKGAFLLLSADYRIGVD
GPFQIGLNEVAIGMTMHHVGIELARDRLRKSAFTRSVINAEMFSPAAAVDAGFLDTLVSA
DQLQESARAAAQQLKKLNMTAHRNTKLKVRKALLETLDQAIELDKKHLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttgatcagctaccagttcgaagacggcatcgccaccctgaccctcaacaac
ggcaaggtgaacgccatctccccggcggtgatcgacgccttcaaccaggctctcgaccag
gccctgcaggacaaggccgtggtcatcgtcaccggccagccgggcatcctctccggtggc
tacgacctgaaggtcatgacctccggcccggagaatgccgtcaacctggtcgccgccggc
tcgaccctggctcgccgcctgctctcccatccctatccggtgatcgtcgcctgccccggg
cacgcggtagccaagggcgccttcttgctgctctcggccgactaccggatcggcgtcgac
gggccgttccagatcggcctgaacgaagtcgccatcggcatgaccatgcaccatgtcggc
atcgaactggcccgcgatcgcctgcgcaagtcggcgttcacccgctcggtcatcaatgcc
gagatgttcagtccggccgctgcggtggatgccggcttcctcgacaccctggtcagcgcc
gaccagttgcaggaaagcgcgcgtgcagcggcccagcagttgaagaaactcaacatgacc
gcgcatcgcaataccaagctcaaggtgcgcaaggcactgctggaaaccctcgaccaggcg
atcgagctggacaagaagcacctgggctaa

DBGET integrated database retrieval system