KEGG   Pseudomonas aeruginosa LESB58: PLES_35921Help
Entry
PLES_35921        CDS       T00818                                 

Definition
putative 3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PLES_35921
   01212 Fatty acid metabolism
    PLES_35921
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PLES_35921
   00650 Butanoate metabolism
    PLES_35921
  Lipid metabolism
   00071 Fatty acid degradation
    PLES_35921
   01040 Biosynthesis of unsaturated fatty acids
    PLES_35921
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PLES_35921
   00310 Lysine degradation
    PLES_35921
   00380 Tryptophan metabolism
    PLES_35921
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PLES_35921
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PLES_35921
   00281 Geraniol degradation
    PLES_35921
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PLES_35921
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PLES_35921
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PLES_35921
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PLES_35921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3985873..3988017)
Genome map
AA seq 714 aa AA seqDB search
MTDAIRYEKGQDNVVVLTMDMPGQSANTMNGVYREAMAKTIARLEAEKEGIAGVVLTSAK
KTFFAGGDLNELIKVTKADAPAFYQGILELKGQLRRLETLGKPVVAAINGAALGGGWEIC
LACHHRIALDNPGVQLGLPEVTLGLLPGGGGIVRMVRLLGLEKALPYLAEGKKVRPAEAL
KAGLIHELADSPEEMLEKARAWILANPAAKQPWDSAGYKIPGGTPASPNVAQLLAIAPSV
LRDKTKGCFPAPEKIMCAAVEGAQVDFDTAQLIEARYFTELTTGQVAKNMIGTFWFQLNE
INAGKSRPQGYPVRATKKVGVLGAGMMGAGIAYVSAAAGIEVVLKDVSLEAAEKGKAYSA
RLLDKKVARGHLSAEKRDAFLARIVPSVSEADFEGCDLIIEAVFEDRALKGKVTAEAEKH
ALADAVVASNTSTLPITGLAQAVARPEKFIGLHFFSPVDKMPLVEIIRGEKTSDETLARG
FDYVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVSAAMIDNQARQAGMPVGPL
AISDEVSLSLMTHIRNQTARDLEAEGKALPTHPAFAVIDLMVNEYKRPGKAAGAGFYDYP
ANGRKHLWAELKSRFEKPDAQISAEDVRDRLLFIQAIETVRCVEEGVLHSTADANIGSIF
GIGFAAWSGGALQFINQYGLKDFIARAQYLVEQYGERFEPPALLLEKAAKGELF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgctatccgttacgaaaaaggccaggacaacgtcgtcgtcctgaccatggac
atgcccgggcagagcgccaacaccatgaacggtgtctaccgcgaggcgatggcgaagacc
atcgcacggctggaggcggagaaagaggggatcgccggcgtggtgctgacctcggcgaag
aagaccttcttcgccggcggcgatctcaacgagctgatcaaggtcaccaaggccgacgcc
ccggccttctaccagggcatcctcgaactcaagggccaactgcggcgcctggagaccctc
ggcaagccggtggtcgccgcgatcaacggcgctgcgctgggcggcggctgggagatctgc
ctggcctgccaccaccgcatcgccctggacaatcccggcgtgcagctcggcctgccggag
gtgactctcggcctgttgccgggcggcggcgggatcgtgcgcatggtgcgcctgcttggc
ctggagaaagccctgccgtacctcgccgaaggcaagaaggtgcgtccggcggaagcgctc
aaggccgggctgatccacgaactggccgacagccccgaggaaatgctggagaaggcccgc
gcctggatcctcgccaacccggcggcgaagcagccctgggacagcgccggctacaagatt
cccggcggtacgcctgccagtcccaacgtggcgcagctgctggccatcgcaccgtcggtg
ctgcgcgacaagaccaagggttgcttcccggcgcccgagaagatcatgtgcgcggcggtg
gagggcgcccaggtcgatttcgacaccgcgcaactgatcgaggcgcgctatttcaccgag
ctgaccaccggccaggtggcgaagaacatgatcggcaccttctggttccagctcaacgag
atcaacgccggcaagtcgcggccgcaggggtatccggtgcgggcgacgaaaaaggtcggc
gtgctcggcgccgggatgatgggcgcgggcatcgcctacgtatcggcggcggccggcatc
gaggtggtgctcaaggacgtctcgctggaagcggcggagaagggcaaggcttattcggcc
aggctgctggacaagaaggttgcgcgcgggcacctgtccgccgagaagcgcgacgccttc
ctcgcgcggatcgtgccgagcgtcagcgaagccgacttcgaaggctgcgacctgatcatc
gaggcggtcttcgaggaccgcgcgctgaaaggcaaggtcaccgccgaggccgagaaacat
gccctggccgatgcggtggtggcgtccaatacctcgaccctgccgatcaccggtctggcc
caggcggtggcgcggccggagaagttcatcggcctgcacttcttcagcccggtggacaag
atgccgctggtggagatcatccgcggcgaaaagaccagtgacgaaaccctggcacgcggt
ttcgactacgtgctgcagatcaagaaaacgccgatcgtggtcaacgacagccgcggcttc
ttcacctcgcgggtattcggcaccttcaccaacgaaggcatcgccatgctcggcgaaggc
gtgagcgccgcgatgatcgacaaccaggcgcgccaggccggtatgccggtggggccgctg
gcgatttccgacgaagtctccctgagcctgatgacccacatccgtaaccagaccgcccgc
gacctcgaggccgagggcaaggctctgccgacgcatcctgcgttcgccgtgatcgacctg
atggtcaatgagtacaagcgcccgggcaaggcggccggcgccggcttctacgactacccg
gcgaacggcaggaaacatctctgggcggaactcaagagccgcttcgagaagcccgatgcg
caaatatccgccgaggacgtacgcgaccgcctgctgttcatccaggccatcgagaccgtg
cgttgcgtggaggagggggtattgcactccaccgccgacgcgaacatcggctcgatcttc
ggtatcggtttcgccgcctggagcgggggcgccttgcagttcatcaaccagtacggcctg
aaggacttcatcgcccgcgcccaatacctggtcgaacagtacggcgagcgcttcgagccg
ccggcgctgttgctggagaaggcggcgaagggcgagctgttctga

DBGET integrated database retrieval system