KEGG   Pseudomonas aeruginosa LESB58: PLES_37401Help
Entry
PLES_37401        CDS       T00818                                 

Gene name
lpdG
Definition
dihydrolipoamide dehydrogenase
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Leucine degradation, leucine => acetoacetate + acetyl-CoA
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PLES_37401 (lpdG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_37401 (lpdG)
   00020 Citrate cycle (TCA cycle)
    PLES_37401 (lpdG)
   00620 Pyruvate metabolism
    PLES_37401 (lpdG)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PLES_37401 (lpdG)
   00280 Valine, leucine and isoleucine degradation
    PLES_37401 (lpdG)
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     PLES_37401 (lpdG)
Exosome [BR:pag04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PLES_37401 (lpdG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4138333..4139769)
Genome map
AA seq 478 aa AA seqDB search
MSQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKAL
LDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEG
HGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLTDDIIVDSTGALEFQAV
PKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIR
LGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGF
IYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTH
PEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVI
GPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIANRKKR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaaattcgacgtggtagtgattggtgccggccccggcggttacgttgccgcc
atccgcgctgcccagctgggcctgaagaccgcctgcatcgagaagtacatcggcaaggaa
ggcaaggtggcgctcggcggtacctgcctgaacgttggctgcatcccgtccaaggcgctg
ctggacagctcctacaagtaccatgaggccaaagaggccttcaaagtccatggtatcgaa
gccaagggcgtcaccatcgacgttccggcgatggttgcgcgcaaggccaacatcgtcaag
aacctgaccggcggcatcgctaccctgttcaaggccaacggcgtgacctccttcgaaggc
cacggcaagctgctggccaacaagcaggtggaagtgaccggcctggacggcaagacccag
gtcctggaagccgagaacgtgatcatcgcttccggctcccgcccggtggagatcccgccg
gccccgctgaccgacgacatcatcgtcgactccaccggcgccctggaattccaggccgtg
ccgaagaagctgggtgtgatcggcgccggcgtcatcggcctggagctgggttcggtatgg
gcccgcctgggtgccgaggtgaccgtgctggaagccctggacaagttcctcccggctgcc
gacgagcagatcgccaaggaagccctgaaggtcctgaccaagcaaggcctgaacattcgc
ctgggtgcccgcgtgaccgcttcggaagtgaagaagaagcaggtcaccgtgaccttcacc
gacgccaacggcgagcagaaggaaaccttcgacaagctgatcgtcgcggtcggccgtcgc
ccggtgaccaccgacctgctggccgccgacagcggcgtgaccctggacgagcgtggcttc
atctacgtcgacgaccactgcaagaccagcgttccgggtgtcttcgccatcggtgacgtg
gttcgcggcgcgatgctcgcgcacaaagcctcggaagagggcgtgatggtcgccgagcgc
atcgccggccacaaggcgcagatgaactacgacctgattccgtcggtcatctacacccac
ccggaaatcgcctgggtcggcaagaccgagcagaccctcaaggccgagggcgtcgaagtc
aacgtcggcaccttcccgttcgccgccagcggtcgcgcgatggcggccaacgacaccacc
ggcctggtcaaggtcatcgccgatgcgaagaccgaccgcgtcctgggcgtccacgtgatc
ggcccgagcgccgccgagctggtacagcaaggcgcgatcggcatggaattcggcaccagc
gccgaagatctgggcatgatggtcttctcccacccgacgctgtccgaagccctgcacgaa
gctgccctggcggtgaatggccatgccatccacatcgccaaccgcaagaagcgctga

DBGET integrated database retrieval system