KEGG   Pseudomonas aeruginosa LESB58: PLES_37451Help
Entry
PLES_37451        CDS       T00818                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase (D subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00020  Citrate cycle (TCA cycle)
pag00190  Oxidative phosphorylation
pag00650  Butanoate metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01200  Carbon metabolism
Module
pag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pag_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PLES_37451 (sdhD)
   00650 Butanoate metabolism
    PLES_37451 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PLES_37451 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: CAW28472
Position
complement(4146693..4147061)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMRIF
SLLTLVALSVHAWVGMWTISTDYLTSMALGKAATVVRFLFQAVCGMAMFAFFVWGVQILW
GM
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactaacgtcacaaacttctcgcgctccggcctctacgactggatggcccagcgc
gtttccgcggtcgttctcgcggcttatgtcattttcctgctgggctacctcattgctcac
cccaacatttcctacgcggactggcacggcctgttctcgcagggttggatgcgcatcttc
agcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatgtggaccatctcc
accgactacctgacttcgatggctctcggcaaggcggcgacagtcgtgcgtttcctcttc
caggcggtttgcggcatggcgatgttcgcattcttcgtctggggtgtgcagattctttgg
ggtatgtga

DBGET integrated database retrieval system