KEGG   Pseudomonas aeruginosa LESB58: PLES_39251Help
Entry
PLES_39251        CDS       T00818                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pag00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4338204..4339619
Genome map
AA seq 471 aa AA seqDB search
MRIAALDQGTTSTRVLVASQDGSADIQLALRHQQHHPQSGWVEHDPLELLANLQRCLEAS
GRVDAIGLANQGESCMAWDARSGEPLSPLIVWQDNRTTPHIERLRASGAEALVLERSGLP
LDAYFSASKLGWIVEHLPAARRALKAGRLRLGTSDAWFLDRLCGTFATDVTTASRTALMN
LAEGRWDPDLCALFGVPIECLPEIRDTVGHFGVIGNTPLTASVVDQQASLYGHGCRQPGD
AKITFGTGAFALTLSGERIIRSPETGLLATIAWQIDGKPVYAMDGGVYDASAAVEWAGRL
GLFSDFSELAGFDRPPAIERGLAFVPALSGLACPHWDRSAGAMWLGMDAGTRREDLCQAL
LEGVVLRSAEVIQAMDGYLKVTDRLSIDGGLARSPYFAQFLSDSLQRRIVTQRFDELTAF
GCAALAARGLGYELAEPRNTRTEFQPRVDAGTARRWQVRFSEAVARTRGWR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgccgccctcgaccagggaaccaccagtacccgcgtgctggtcgccagccag
gacggcagcgccgatattcagttggcgctgcgtcaccagcaacaccatccgcagtccggc
tgggtcgagcacgatccgctggaactgctggccaacctgcaacgctgcctggaggccagc
ggccgggtcgacgccatcggcctcgccaaccagggcgaaagctgcatggcctgggacgcc
cgcagcggcgagccgttgtcgccgctgatcgtctggcaggacaaccgcaccaccccgcac
atcgagcgtctacgcgccagcggcgccgaggctctggtcctggaacgcagcggcctgccg
ctcgacgcctatttctcggccagcaagctgggctggatcgtcgagcaccttccggccgct
cgcagggctttgaaggcaggccgcctgcgcctgggaaccagcgatgcctggtttctcgac
cgcttgtgcggaaccttcgccaccgacgtcaccaccgcctcgcgtaccgcattgatgaac
ctcgccgagggccgctgggaccccgacctgtgcgccctgttcggcgtgccgatcgagtgc
ctgccggaaatccgcgataccgtcggccatttcggggtgatcggcaacaccccgctgacg
gcctcggtggtcgaccagcaggcctcgctctacggtcacggctgccgccagcccggtgat
gcgaagatcaccttcggcaccggcgccttcgccctgactctcagcggcgagcggatcatc
cgctcgccggagacaggcctgctcgccaccatcgcctggcagatcgatggcaaaccggtg
tacgccatggacggcggggtctacgacgccagcgccgcggtcgagtgggccgggcgtctc
ggcctgttcagcgacttctcggaactggccggcttcgaccggccgccggccatcgagcgc
ggcctggccttcgtcccggccctgtcgggactcgcatgcccgcactgggaccgcagcgcc
ggcgcgatgtggctgggaatggacgccggcacccgccgcgaggacctctgccaggccctg
ctcgaaggcgtggtgctacgcagcgccgaggtgatccaggcgatggacggctacctgaag
gtcaccgaccgcctgtccatcgacggcggcctggcgcgcagcccctacttcgcccagttc
ctctccgacagcctgcaacggcgcatcgtcacccagcgcttcgacgaactcaccgccttc
ggttgcgccgcccttgccgcgcgtggcctcggctacgagctggcggagccgcgcaacacc
cgcacggagttccagccgcgggtcgacgccggcaccgcccggcgctggcaggtgcgtttc
agcgaagcggtggcgcgcacccgcggctggcgctga

DBGET integrated database retrieval system