KEGG   Pseudomonas aeruginosa LESB58: PLES_41041Help
Entry
PLES_41041        CDS       T00818                                 

Definition
putative pirin protein
Orthology
K06911  
 
Organism
pag  Pseudomonas aeruginosa LESB58
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4532987..4533934)
Genome map
AA seq 315 aa AA seqDB search
MSNTEERCDLSSSRDCPERREHLLQRVTARAAEIGGGITVSRLMPSRQRRMIGAWCFLDH
AGPAEFEPGGGLAVGPHPHIGLQTFTWMIQGEALHRDSLGNVQVIRPGQVNLMTAGHGIA
HTEESLPDERHAHAAQLWIALPYEQRDIAPAFDHHPDLPRWQEQGVTFTLLAGALAGRQA
PCRLYSPLLGADLACHDASTLQLTLDPHFEYGLLPLEGGLEVGGEHFAVNELAYLGDGRD
GLQLQLDPGARVLLLGGAPFGAEIFMWWNFVGHSKGEIARAQKAWEEGDARFGRLDALEG
PRLSAPPIPWKIDAE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataccgaagagcgttgcgacctgtcctcctcgcgggactgtccggaacgccgc
gaacacctgctgcaacgggtcaccgcgcgtgccgcggaaatcggcggcgggatcaccgtc
agtcggctgatgccgtcgcgccagcggcggatgatcggtgcctggtgcttcctcgaccat
gccggtcccgccgaattcgaacctggcggcggcctggccgtgggcccgcacccgcacatc
ggcctgcagacctttacctggatgatccagggcgaggcgttgcaccgcgacagcctgggc
aacgtccaggtgatccgccccggccaggtcaacctgatgaccgccggtcatggcatcgcc
cacaccgaggagtcgctgcccgacgagcgccacgcccacgccgcgcagttgtggatcgcg
ctgccctacgagcagcgcgacatcgccccggccttcgaccatcatcccgacctgccgcgc
tggcaggagcagggggtcaccttcaccctgctggccggtgcgctggccgggcgacaggcg
ccgtgccggctctactcgccgctgctcggtgccgacctggcctgccacgacgcctcgacc
ctgcaactgacgctcgacccgcacttcgagtacggcctgctgccgctggaaggcgggttg
gaagtgggcggcgagcatttcgcggtgaacgaactggcctacctgggcgacggccgcgac
ggcctgcaactgcaactcgaccctggcgcgcgggtgctgttgctgggtggcgcaccgttc
ggtgcggagatcttcatgtggtggaacttcgtcggccacagcaagggcgagatcgcccgg
gcgcagaaggcctgggaggagggggatgcccgcttcggccggctcgacgccctggaaggg
ccgcgcttgagcgctccgccgattccctggaagatcgacgccgagtga

DBGET integrated database retrieval system