KEGG   Pseudomonas aeruginosa LESB58: PLES_41591Help
Entry
PLES_41591        CDS       T00818                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pag01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pag00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4588527..4589678
Genome map
AA seq 383 aa AA seqDB search
MTASSPSLSPTLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEEVDNFWAR
RGGDGPVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVE
RFVADHPEHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDV
VKNGRRGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQ
VSNLNSGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLDWHVEWALSGLP
FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVNE
RVLASDLELLTEIYYQTLVRLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcttcgccgagtctctcgccgaccctcgaactcgcctgcgagttgatccgc
cgcccctccgtcacgcccctcgacgccgactgccaggccctgatgatgcgccgcctggaa
gccgccggcttcgccctggagccgatgcgcatcgaggaggtggacaacttctgggcacgg
cgcggcggcgacggcccggtgctgtgcttcgccgggcacaccgacgtggtccccaccggc
ccgctgcaggcctggcagcaccaacccttcgacgccctgatcgacgaccagggcatgctc
tgcgggcgcggcgcggcggacatgaaaggcagcctggcgtcgatgatcgtcgccgtcgag
cgcttcgtcgccgaccacccggagcacaagggtgccatcgccttcctcatcaccagcgac
gaggaaggcccggcccaccacggcaccaaggcggtggtcgaacgcctcgccgcacgcggc
gagcgcctggactggtgcatcgtcggcgaaccgtcgagcaccagcctggtcggcgacgtg
gtgaagaacggccgccgcggctccctcggcgccaagctgaccatccgcggcgtacagggc
catgtggcctacccgcacctggcgaagaacccgatccacctggccgccccggcgctggcc
gaactggcggcggaacactgggacgacggcaatgccttcttcccgccgaccagcttccag
gtttccaacctgaactccggcaccggcgccaccaacgtcatccccggcgaactgaccgcg
ctgttcaacttccgcttctccaccgaatccaccgtcgaaggcctgcagaaacgcgtcgag
gcgatcctcgacaagcacggcctggactggcacgtcgaatgggcgctgtccggcctgccg
ttcctcaccgagccgggcgaactgctcgatgcggtggccgccagcatcagggcggtcacc
ggtcgcgagacccagccctcgaccagcggcggcacctccgacggacgcttcatcgccacc
atgggcacccaggtggtcgaactcggcccggtcaacgccaccatccaccaggtcaacgag
cgggtcctggccagcgacctggaactgctcaccgaaatctactaccagaccctggtgagg
ctgctcgcctga

DBGET integrated database retrieval system