KEGG   Pseudomonas aeruginosa LESB58: PLES_41591Help
Entry
PLES_41591        CDS       T00818                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00300  Lysine biosynthesis
pag01100  Metabolic pathways
pag01120  Microbial metabolism in diverse environments
pag01230  Biosynthesis of amino acids
Module
pag_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PLES_41591 (dapE)
Enzymes [BR:pag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PLES_41591 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer BNR_2
Motif
Other DBs
NCBI-ProteinID: CAW28914
UniProt: B7UX27
Position
4588527..4589678
Genome map
AA seq 383 aa AA seqDB search
MTASSPSLSPTLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEEVDNFWAR
RGGDGPVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVE
RFVADHPEHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDV
VKNGRRGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQ
VSNLNSGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLDWHVEWALSGLP
FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVNE
RVLASDLELLTEIYYQTLVRLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcttcgccgagtctctcgccgaccctcgaactcgcctgcgagttgatccgc
cgcccctccgtcacgcccctcgacgccgactgccaggccctgatgatgcgccgcctggaa
gccgccggcttcgccctggagccgatgcgcatcgaggaggtggacaacttctgggcacgg
cgcggcggcgacggcccggtgctgtgcttcgccgggcacaccgacgtggtccccaccggc
ccgctgcaggcctggcagcaccaacccttcgacgccctgatcgacgaccagggcatgctc
tgcgggcgcggcgcggcggacatgaaaggcagcctggcgtcgatgatcgtcgccgtcgag
cgcttcgtcgccgaccacccggagcacaagggtgccatcgccttcctcatcaccagcgac
gaggaaggcccggcccaccacggcaccaaggcggtggtcgaacgcctcgccgcacgcggc
gagcgcctggactggtgcatcgtcggcgaaccgtcgagcaccagcctggtcggcgacgtg
gtgaagaacggccgccgcggctccctcggcgccaagctgaccatccgcggcgtacagggc
catgtggcctacccgcacctggcgaagaacccgatccacctggccgccccggcgctggcc
gaactggcggcggaacactgggacgacggcaatgccttcttcccgccgaccagcttccag
gtttccaacctgaactccggcaccggcgccaccaacgtcatccccggcgaactgaccgcg
ctgttcaacttccgcttctccaccgaatccaccgtcgaaggcctgcagaaacgcgtcgag
gcgatcctcgacaagcacggcctggactggcacgtcgaatgggcgctgtccggcctgccg
ttcctcaccgagccgggcgaactgctcgatgcggtggccgccagcatcagggcggtcacc
ggtcgcgagacccagccctcgaccagcggcggcacctccgacggacgcttcatcgccacc
atgggcacccaggtggtcgaactcggcccggtcaacgccaccatccaccaggtcaacgag
cgggtcctggccagcgacctggaactgctcaccgaaatctactaccagaccctggtgagg
ctgctcgcctga

DBGET integrated database retrieval system