KEGG   Pseudomonas aeruginosa LESB58: PLES_42241Help
Entry
PLES_42241        CDS       T00818                                 

Gene name
fleQ
Definition
(GenBank) transcriptional regulator FleQ
  KO
K10941  
sigma-54 dependent transcriptional regulator, flagellar regulatory protein
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Two-component system
Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PLES_42241 (fleQ)
 Cellular Processes
  Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PLES_42241 (fleQ)
Transcription factors [BR:pag03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    PLES_42241 (fleQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(4658288..4659760)
Genome map
AA seq 490 aa AA seqDB search
MWRETKLLLIDDNLDRSRDLAVILNFLGEDQLTCNSEDWREVAAGLSNSREALCVLLGSV
ESKGGAVELLKQLASWDEYLPILLIGEPAPADWPEELRRRVLASLEMPPSYNKLLDSLHR
AQVYREMYDQARERGRSREPNLFRSLVGTSRAIQQVRQMMQQVADTDASVLILGESGTGK
EVVARNLHYHSKRREGPFVPVNCGAIPAELLESELFGHEKGAFTGAITSRAGRFELANGG
TLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNKTQNVDVRIIAATHKNLEKMIEDGTFR
EDLYYRLNVFPIEMAPLRERVEDIALLLNELISRMEHEKRGSIRFNSAAIMSLCRHDWPG
NVRELANLVERLAIMHPYGVIGVGELPKKFRHVDDEDEQLASSLREELEERAAINAGLPG
MDAPAMLPAEGLDLKDYLANLEQGLIQQALDDAGGVVARAAERLRIRRTTLVEKMRKYGM
SRRDDDLSDD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgaaaccaaactcttgctgattgacgacaatctcgatcgcagtcgcgacctg
gcagtcattctcaacttcctcggcgaagatcagctgacctgcaacagcgaggattggcga
gaggtagcggcgggcctgagcaacagtcgcgaagccctgtgcgtgctgctcggcagcgtc
gagtcgaagggcggggcggtagagctgctgaagcagctggccagttgggacgagtacctg
ccgatcctgctgatcggcgagccggccccggccgactggccggaagagctgcgccgccgg
gtgctcgccagcctggagatgccgcccagctacaacaagctgctcgattccctgcatcgc
gcccaggtctaccgcgagatgtacgaccaggcccgcgagcgcggccgctcccgcgagccg
aacctgttccgcagcctggtcggcaccagccgggcgatccagcaggtgcggcagatgatg
cagcaggtcgccgataccgatgccagcgtgctgatcctcggcgagtccggcaccggcaag
gaagtggtggcgcgcaacctgcattaccattccaagcgccgcgaggggcccttcgtcccg
gtgaactgcggggcgatcccggcggaactgctggaaagcgaactgttcggccacgagaag
ggcgccttcaccggtgccatcaccagtcgtgccggacgtttcgagctggccaacggcggc
accctgttcctcgacgagatcggcgacatgccgctgccgatgcaggtcaagctgctgcgc
gtgctgcaggagcgcaccttcgaaagggtcggcagcaacaagacgcagaacgtcgacgtg
cggatcatcgccgcgacccacaagaacctcgagaagatgatcgaggacggcactttccgc
gaagacctctactaccgcctcaacgtattccccatcgagatggcgccgctgcgcgagcgg
gtggaagacatcgccctgctgctcaacgaactgatctcgcggatggagcatgagaagcgc
gggtcgatccgcttcaactcggcagcgatcatgtcgctctgccgccacgactggccgggc
aacgtccgcgaactggcgaacctggtggagcgcctggcgatcatgcatccttacggggtg
atcggggtcggcgaactgccgaagaaattccgccatgtcgacgacgaggacgagcaactc
gccagcagcctgcgcgaagagctggaagagcgcgcggcgatcaacgccgggctgccggga
atggacgcgccggcgatgctgccggccgaaggcctggaccttaaggactacctggccaac
ctcgagcagggcctgatccagcaggccctcgacgatgccggcggagtggtcgcgcgggcc
gccgaacgcctgcgcatccgccgcaccacgctggtggagaagatgcgcaagtacggcatg
agccggcgcgacgacgacctgtcggatgattga

DBGET integrated database retrieval system