KEGG   Pseudomonas aeruginosa LESB58: PLES_42241Help
Entry
PLES_42241        CDS       T00818                                 

Gene name
fleQ
Definition
transcriptional regulator FleQ
Orthology
K10941  
sigma-54 specific transcriptional regulator, flagellar regulatory protein A
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pag02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4658288..4659760)
Genome map
AA seq 490 aa AA seqDB search
MWRETKLLLIDDNLDRSRDLAVILNFLGEDQLTCNSEDWREVAAGLSNSREALCVLLGSV
ESKGGAVELLKQLASWDEYLPILLIGEPAPADWPEELRRRVLASLEMPPSYNKLLDSLHR
AQVYREMYDQARERGRSREPNLFRSLVGTSRAIQQVRQMMQQVADTDASVLILGESGTGK
EVVARNLHYHSKRREGPFVPVNCGAIPAELLESELFGHEKGAFTGAITSRAGRFELANGG
TLFLDEIGDMPLPMQVKLLRVLQERTFERVGSNKTQNVDVRIIAATHKNLEKMIEDGTFR
EDLYYRLNVFPIEMAPLRERVEDIALLLNELISRMEHEKRGSIRFNSAAIMSLCRHDWPG
NVRELANLVERLAIMHPYGVIGVGELPKKFRHVDDEDEQLASSLREELEERAAINAGLPG
MDAPAMLPAEGLDLKDYLANLEQGLIQQALDDAGGVVARAAERLRIRRTTLVEKMRKYGM
SRRDDDLSDD
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgaaaccaaactcttgctgattgacgacaatctcgatcgcagtcgcgacctg
gcagtcattctcaacttcctcggcgaagatcagctgacctgcaacagcgaggattggcga
gaggtagcggcgggcctgagcaacagtcgcgaagccctgtgcgtgctgctcggcagcgtc
gagtcgaagggcggggcggtagagctgctgaagcagctggccagttgggacgagtacctg
ccgatcctgctgatcggcgagccggccccggccgactggccggaagagctgcgccgccgg
gtgctcgccagcctggagatgccgcccagctacaacaagctgctcgattccctgcatcgc
gcccaggtctaccgcgagatgtacgaccaggcccgcgagcgcggccgctcccgcgagccg
aacctgttccgcagcctggtcggcaccagccgggcgatccagcaggtgcggcagatgatg
cagcaggtcgccgataccgatgccagcgtgctgatcctcggcgagtccggcaccggcaag
gaagtggtggcgcgcaacctgcattaccattccaagcgccgcgaggggcccttcgtcccg
gtgaactgcggggcgatcccggcggaactgctggaaagcgaactgttcggccacgagaag
ggcgccttcaccggtgccatcaccagtcgtgccggacgtttcgagctggccaacggcggc
accctgttcctcgacgagatcggcgacatgccgctgccgatgcaggtcaagctgctgcgc
gtgctgcaggagcgcaccttcgaaagggtcggcagcaacaagacgcagaacgtcgacgtg
cggatcatcgccgcgacccacaagaacctcgagaagatgatcgaggacggcactttccgc
gaagacctctactaccgcctcaacgtattccccatcgagatggcgccgctgcgcgagcgg
gtggaagacatcgccctgctgctcaacgaactgatctcgcggatggagcatgagaagcgc
gggtcgatccgcttcaactcggcagcgatcatgtcgctctgccgccacgactggccgggc
aacgtccgcgaactggcgaacctggtggagcgcctggcgatcatgcatccttacggggtg
atcggggtcggcgaactgccgaagaaattccgccatgtcgacgacgaggacgagcaactc
gccagcagcctgcgcgaagagctggaagagcgcgcggcgatcaacgccgggctgccggga
atggacgcgccggcgatgctgccggccgaaggcctggaccttaaggactacctggccaac
ctcgagcagggcctgatccagcaggccctcgacgatgccggcggagtggtcgcgcgggcc
gccgaacgcctgcgcatccgccgcaccacgctggtggagaagatgcgcaagtacggcatg
agccggcgcgacgacgacctgtcggatgattga

DBGET integrated database retrieval system