KEGG   Pseudomonas aeruginosa LESB58: PLES_43481Help
Entry
PLES_43481        CDS       T00818                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PLES_43481 (ruvA)
Enzymes [BR:pag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PLES_43481 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4786113..4786718)
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGVGYEVEVPMTTLYRLPSVGEPVTLHTHLVVREDAHLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSTLVKIPGVGKKT
AERLLVELKDRFKAWENMPTIAPLVMEPRASATVSSAEADAVSALIALGFKPQEASRAVA
AVPGEDLSSEEMIRQALKGMV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgcttgcgtggcaccctggcggagaaacagccgccacacctgatcctcgat
gtgaatggcgtcggctatgaagtggaagtgccgatgacgaccctctatcggttgccttcg
gtgggcgagccggtgaccttgcatacccatctggttgtgcgtgaggatgcgcacttgctc
tatggcttcgccgaaaagcgcgagcgagagctgttccgtgagctgatccggctcaacggc
gtgggtccgaaactggccctggcgctgatgtcgggcctggaagtggacgaactggtgcgt
tgcgtccaggcacaggacacctccaccctggtgaagatccccggtgttggcaagaagacc
gccgagcgcctgctggtggagttgaaggaccgcttcaaggcttgggaaaacatgcccacg
attgcaccgttggtgatggaaccccgtgccagcgctacagtctcaagcgccgaggccgat
gcagtcagcgcgctgatcgccctcggcttcaagccacaggaagccagtcgtgccgtcgca
gccgtaccgggagaggatttgtccagcgaagaaatgatccgccaggccctgaagggcatg
gtctag

DBGET integrated database retrieval system