KEGG   Pseudomonas aeruginosa LESB58: PLES_46631Help
Entry
PLES_46631        CDS       T00818                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PLES_46631 (recD)
Enzymes [BR:pag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PLES_46631 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5139015..5141180)
Genome map
AA seq 721 aa AA seqDB search
MNPTLKQLAGEVRDGRDDQVAQPLAVRHDLLRQLDLWVARGWLRALDRAFVAFLVELQPQ
ADPRVLLAAALTSHQLGHGHVCLDLEATLGAPDAALSLPPEGDEGRDVLLPSQLLHGVRL
DAWREALAASPLVEVVDERPGDPEPSETATSPLVLCAQRLYLRRYWRHELEIALALRERL
GRQAPLAADLAPRLAALFAQAPTEDGQRVTDWQKLACALAARGYFSLITGGPGTGKTTTV
VRLLGLLQAPAVAAGQPLRIRLAAPTGKAAARLSESIGQQVRALPLAEDVLQAIPAEVTT
LHRLLGSRPDTRHFRHHRDNPLALDVLVVDEASMIDLEMMASLLDALPPQARLILLGDKD
QLASVEAGAVLGDLCRDAEEGCYSAETRAWLQRVSGETWQGLREGSAQAHPLAQQTVMLR
HSRRFGASSGIGRLARLVNRQQAGDARALLDSPPADLFDLRLRGERDAAFARLFVDGHPQ
APGTPYGYRHYLQRLAEGRPAAGLALEDGAWERWAQSVLTAFDAFRLLCALRRGPWGVEG
LNQRVAAELLRLGLIEADHGWYEGRPVLVTRNDYSLGLMNGDIGIALRLPERNDDGSLRF
ALRVAFPRNDGSGGVRFVLPSRLVEVDTVFAMTVHKSQGSEFAHTALVLPDALNPVLTKE
LVYTGITRARDWFSLVESLPGVFEEAVRRKVRRLSGLMLHLRPEREEQPPHAPGEQTELP
F
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaccctcaagcaactggccggcgaagtccgcgatggccgcgacgatcaggta
gcgcaaccgctggcggtacgccacgacctgctgcgtcagctcgacctgtgggtggcgcgc
ggctggctacgggcgctggaccgggcgttcgtcgccttcctcgtcgagttgcagccgcag
gccgatccccgggtgctgctggcggcggcgctgaccagccaccaactgggccacggtcac
gtctgcctggacctggaggcgaccctcggcgcgcccgacgcggcgctctcgctgccgccg
gaaggcgacgaaggccgcgatgtgctgttgccgtcgcaactgctgcacggcgtgcgcctc
gacgcctggcgcgaggccctggcggcgtcaccgctggtggaggtggtcgacgagcgccca
ggcgatcccgagccgagcgagacggcgacctcgccgctggtgctttgcgcccagcgtctc
tacctgcgtcgttattggcggcacgagttggagatcgccctggccctgcgcgagcgcctg
ggtcggcaggcgcccctggccgccgacctggcgccgcgcctggccgcgctgttcgcgcag
gcgccgacggaagacggccagcgcgtcaccgactggcagaagctggcctgcgccctggcg
gcccgcggctatttcagcctgatcaccggcggtcccggtaccggcaagaccaccaccgtg
gtgcgcctgctcggtctgctccaggctccggcggtagccgccggccagccgctgcgcatc
cgcctcgcggcgcctaccggcaaggccgcggcgcgtctctccgaatccatcggccagcag
gtccgggccctgccgctggcggaagacgtgttgcaggcgatccccgccgaggtcactacc
ctgcaccgtctgcttggcagccgtccggatacccggcacttccgccaccaccgggacaac
cctttggcgctggacgtgctggtggtggatgaggcctcgatgatcgacctggaaatgatg
gccagcctgctcgatgcgctaccgccgcaggcgcgcctgatcctgctcggcgacaaggac
cagttggcctcggtagaggccggcgcggtgctcggcgatctctgccgggatgccgaggag
ggctgttacagcgccgagacccgcgcctggttgcagcgggtcagcggcgaaacctggcag
ggcttgcgcgaaggttcggcgcaggcgcatccgctggcgcaacagaccgtcatgctgcgg
cattcccggcgcttcggcgcgagcagcgggatcgggcgcctggcgcggttggtcaaccgg
caacaggccggcgacgcgcgcgcgctgctggacagtccgcccgccgacctcttcgacctg
cgcctgcgcggggagcgcgatgcagccttcgcccggctgttcgtcgacggtcatccgcag
gcgccgggcacgccgtacggctaccggcactacctacaacgcctggccgagggccgcccg
gccgccggactggcgctggaggatggcgcctgggagcgctgggcgcagtcggtactgacg
gctttcgacgccttccgcctgctctgcgcgctgcgccgcggcccatggggcgtggaagga
ctgaaccagcgggtagcggcagaactgctgcgccttggcctgatcgaggccgatcacggc
tggtacgaggggcggccggtactggtgacgcgcaacgactacagcctggggctgatgaac
ggcgatatcggcatcgccctgcgcctgcccgagcgcaacgacgacggcagcctgcgcttc
gcgctgcgcgtggccttcccgcgcaacgacggtagcggcggcgtgcgcttcgtcctgccg
agccgcctggtcgaggtggacaccgtgttcgccatgaccgtgcacaagtcgcagggttcg
gagttcgcccataccgcgctggtcctgccggacgcgctgaacccggtgctgaccaaggag
ctggtgtacaccggtatcacccgcgcccgcgactggttcagcctggtggaaagcctgccc
ggggtgttcgaggaagcagtgcggcgcaaggtgcgccggctcagcgggctgatgctgcat
ctgcggccggaaagggaagagcagccgccgcatgctccgggtgaacagaccgagctgccg
ttctga

DBGET integrated database retrieval system