KEGG   Pseudomonas aeruginosa LESB58: PLES_51131Help
Entry
PLES_51131        CDS       T00818                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pag00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5644545..5645033
Genome map
AA seq 162 aa AA seqDB search
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVA
ALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQ
ARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatccagcgcgtctacgtggcgctgggcagcaacctggccgaaccgcgcgagcagatc
caggctgccctcgatgccttcgagcggcttcccgagacccgcctggtcgccgtctcgccg
ctctatatcagcgacccgctcggccccgccgaccagccgcgcttcgtcaacggcgtggcg
gccctcgacaccaacctggcgccgctcgacctgctcgacgccctgcaggccatcgaactg
gaacaggggcgcgtccgcgacctgcgctggggtccgcgcacgctcgacctggacatcctg
ctgttcggcgaacaattgctcgacctgccgcgcctgaaggtgccgcactaccacatgcag
gcgcgcgctttcgtgctctatcccctcgccgatctcgcccccgacctgcgcctgcccgat
ggccgccacctgccggagctgctcgcggcctgtccgttcgagggcatcgaacgccttccg
ggcgcctga

DBGET integrated database retrieval system