KEGG   Pseudomonas aeruginosa LESB58: PLES_51181Help
Entry
PLES_51181        CDS       T00818                                 

Gene name
acsB
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00010  Glycolysis / Gluconeogenesis
pag00620  Pyruvate metabolism
pag00640  Propanoate metabolism
pag00680  Methane metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_51181 (acsB)
   00620 Pyruvate metabolism
    PLES_51181 (acsB)
   00640 Propanoate metabolism
    PLES_51181 (acsB)
  Energy metabolism
   00680 Methane metabolism
    PLES_51181 (acsB)
Enzymes [BR:pag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PLES_51181 (acsB)
Lipid biosynthesis proteins [BR:pag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PLES_51181 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAW29872
Position
5649352..5651289
Genome map
AA seq 645 aa AA seqDB search
MFEISVHPVPDAVRQRAYLNDDDYQRLYRQSVENPEEFWGEQAKAFLDWFKPWHSVHHGD
LRKGQATWFKGGQLNVAYNCIDRHLERRGEQIAIVWEGDNPSESAHITYRKLHHNVCRLA
NVLKSRGVEKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCR
TVITADEGVRGGKYIPLKQNVEKALKDCPDVSTVVVVERTQGDIPWVEGRDIWYHEALHA
ASADCPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHDGDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRA
LMREGDAPVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPIVDTWWQTETGSILI
TPLPGATALKPGSATRPFFGVQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQR
MIDTYFKPYPGYYFSGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGCPHDVKGQAIYAFVTLMAGSQPSEALQQELLALVGKEIGSFAKPDHLQWAPSLP
KTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcagcgtccacccggtgccggacgccgtccgccagcgtgcctacctgaac
gacgacgactaccagcgcctgtaccgccaatccgtcgagaaccccgaagagttctggggc
gagcaggccaaggccttcctcgattggttcaagccctggcacagcgtccaccacggcgac
ctgaggaaaggccaggccacctggttcaagggcggccagttgaacgtcgcctacaactgc
atcgaccgccacctggaacgccgcggcgaacagatcgcgatcgtctgggaaggcgacaac
cccagcgaatccgcgcacatcacctaccgcaagctgcaccacaacgtctgccgcctggct
aacgtgctgaagagccgcggcgtggaaaagggcgaccgggtctgcatctacatgccgatg
attcccgaggccgcctacgccatgctcgcctgcgcccgcatcggggcggtgcactcggtg
gtgttcggcggcttctcgccggactcgctgcgcgaccgcattctcgatgccgactgccgc
accgtgatcaccgccgacgagggcgtgcgcggcggcaagtacatcccgctgaagcagaat
gtggaaaaggcgctgaaggactgcccggacgtctccaccgtggtggtagtcgagcgcacc
cagggcgacataccctgggtcgaaggccgcgacatctggtaccacgaggcgctccacgcg
gcctcagccgactgcccggcggaagcgatggacgccgaggacccgctgttcatcctctat
acctccggcagcaccggcaagccgaagggcgtgttgcacaccaccgggggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgatggcgacgtctactggtgc
accgccgacgtcggctgggtcaccggacacagctatatcgtctacggcccgctggccaac
ggcgccaccaccctgatgttcgagggcgtgcccaactacccggacgcctcgcgcttctgg
caagtgatcgacaagcaccaggtgaatatcttctacaccgcgccgaccgcgatccgcgcg
ctgatgcgcgaaggcgacgccccggtccgccagacctcccgcagcagcctgcgcctgctc
ggctcggtgggcgagccgatcaaccccgaggcctgggagtggtactaccaggtggtcggc
gagaagcgctgccccatcgtcgatacctggtggcagactgagaccggcagcatcctgatc
accccgttgcccggcgccactgcgctaaagccaggctcggcgacccgcccgttcttcggc
gtgcaacccgtgctgctcgacgagaaaggcaaggaaatcgacggcgcgggcagcggcgta
ctggcgatcaaggccagttggccgagtcagatccgcagcgtctacggcgaccaccagcgg
atgatcgacacctacttcaagccctaccccgggtattacttcagcggcgacggcgcgcgc
cgcgacgaggacggctactactggatcaccggccgggtcgacgacgtgatcaatgtctcc
ggacaccggatcggcaccgccgaggtcgagagcgcgctggtcctgcacgatgcggtggcc
gaggcggcggtggtcggctgcccgcatgacgtgaagggccaggccatctacgcgttcgtc
accctgatggccggcagtcagcccagcgaggcgctgcaacaggaattgctggccctggtc
ggcaaggagatcggcagcttcgccaagccggatcacctgcaatgggcgcccagcctgccg
aagacccgctccggcaagatcatgcggcgtatcctgcgcaagatcgcctgcaacgagctg
gacagtctcggcgatacctcgaccctggccgatccgggagtggtgcaggggttgatcgac
aaccgcctcaaccgctga

DBGET integrated database retrieval system