KEGG   Pseudomonas aeruginosa LESB58: PLES_51181Help
Entry
PLES_51181        CDS       T00818                                 

Gene name
acsB
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pag01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pag00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pag00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pag00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pag00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5649352..5651289
Genome map
AA seq 645 aa AA seqDB search
MFEISVHPVPDAVRQRAYLNDDDYQRLYRQSVENPEEFWGEQAKAFLDWFKPWHSVHHGD
LRKGQATWFKGGQLNVAYNCIDRHLERRGEQIAIVWEGDNPSESAHITYRKLHHNVCRLA
NVLKSRGVEKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCR
TVITADEGVRGGKYIPLKQNVEKALKDCPDVSTVVVVERTQGDIPWVEGRDIWYHEALHA
ASADCPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHDGDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRA
LMREGDAPVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPIVDTWWQTETGSILI
TPLPGATALKPGSATRPFFGVQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQR
MIDTYFKPYPGYYFSGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGCPHDVKGQAIYAFVTLMAGSQPSEALQQELLALVGKEIGSFAKPDHLQWAPSLP
KTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcagcgtccacccggtgccggacgccgtccgccagcgtgcctacctgaac
gacgacgactaccagcgcctgtaccgccaatccgtcgagaaccccgaagagttctggggc
gagcaggccaaggccttcctcgattggttcaagccctggcacagcgtccaccacggcgac
ctgaggaaaggccaggccacctggttcaagggcggccagttgaacgtcgcctacaactgc
atcgaccgccacctggaacgccgcggcgaacagatcgcgatcgtctgggaaggcgacaac
cccagcgaatccgcgcacatcacctaccgcaagctgcaccacaacgtctgccgcctggct
aacgtgctgaagagccgcggcgtggaaaagggcgaccgggtctgcatctacatgccgatg
attcccgaggccgcctacgccatgctcgcctgcgcccgcatcggggcggtgcactcggtg
gtgttcggcggcttctcgccggactcgctgcgcgaccgcattctcgatgccgactgccgc
accgtgatcaccgccgacgagggcgtgcgcggcggcaagtacatcccgctgaagcagaat
gtggaaaaggcgctgaaggactgcccggacgtctccaccgtggtggtagtcgagcgcacc
cagggcgacataccctgggtcgaaggccgcgacatctggtaccacgaggcgctccacgcg
gcctcagccgactgcccggcggaagcgatggacgccgaggacccgctgttcatcctctat
acctccggcagcaccggcaagccgaagggcgtgttgcacaccaccgggggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgatggcgacgtctactggtgc
accgccgacgtcggctgggtcaccggacacagctatatcgtctacggcccgctggccaac
ggcgccaccaccctgatgttcgagggcgtgcccaactacccggacgcctcgcgcttctgg
caagtgatcgacaagcaccaggtgaatatcttctacaccgcgccgaccgcgatccgcgcg
ctgatgcgcgaaggcgacgccccggtccgccagacctcccgcagcagcctgcgcctgctc
ggctcggtgggcgagccgatcaaccccgaggcctgggagtggtactaccaggtggtcggc
gagaagcgctgccccatcgtcgatacctggtggcagactgagaccggcagcatcctgatc
accccgttgcccggcgccactgcgctaaagccaggctcggcgacccgcccgttcttcggc
gtgcaacccgtgctgctcgacgagaaaggcaaggaaatcgacggcgcgggcagcggcgta
ctggcgatcaaggccagttggccgagtcagatccgcagcgtctacggcgaccaccagcgg
atgatcgacacctacttcaagccctaccccgggtattacttcagcggcgacggcgcgcgc
cgcgacgaggacggctactactggatcaccggccgggtcgacgacgtgatcaatgtctcc
ggacaccggatcggcaccgccgaggtcgagagcgcgctggtcctgcacgatgcggtggcc
gaggcggcggtggtcggctgcccgcatgacgtgaagggccaggccatctacgcgttcgtc
accctgatggccggcagtcagcccagcgaggcgctgcaacaggaattgctggccctggtc
ggcaaggagatcggcagcttcgccaagccggatcacctgcaatgggcgcccagcctgccg
aagacccgctccggcaagatcatgcggcgtatcctgcgcaagatcgcctgcaacgagctg
gacagtctcggcgatacctcgaccctggccgatccgggagtggtgcaggggttgatcgac
aaccgcctcaaccgctga

DBGET integrated database retrieval system