KEGG   Pseudomonas aeruginosa LESB58: PLES_54051Help
Entry
PLES_54051        CDS       T00818                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pag01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pag00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pag00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pag00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5973624..5975267
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDIGNGEGEVIELLVKPGDKVEADQSLLTLESDKASMEIPSPKAGVVKSIKAK
VGDTLKEGDEILELEVEGGEQPAEAKAEAAPAQPEAPKAEAPAPAPSESKPAAPAAASVQ
DIKVPDIGSAGKANVIEVMVKAGDTVEADQSLITLESDKASMEIPSPASGVVESVSIKVG
DEVGTGDLILKLKVEGAAPAAEEQPAAAPAQAAAPAAEQKPAAAAPAPAKADTPAPVGAP
SRDGAKVHAGPAVRMLAREFGVELSEVKASGPKGRILKEDVQVFVKEQLQRAKSGGAGAT
GGAGIPPIPEVDFSKFGEVEEVAMTRLMQVGAANLHRSWLNVPHVTQFDQSDITDMEAFR
VAQKAAAEKAGVKLTVLPILLKACAHLLKELPDFNSSLAPSGKALIRKKYVHIGFAVDTP
DGLLVPVIRDVDRKSLLQLAAEAAELADKARNKKLSADAMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGELLA
DIRTLLL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacccgacatcggcaacggtgagggtgaagtcatcgagctg
ctggtcaagcccggcgacaaggtcgaggccgatcagagcctgctgaccctggaatccgac
aaggccagcatggaaatccccagtcccaaggccggggtagtgaaaagcatcaaggcgaag
gtcggcgacaccttgaaagaaggtgacgaaatcctcgagctggaagtggaaggcggcgaa
cagcctgccgaagccaaggccgaggcagcgcccgcccaaccggaagcgccgaaagccgaa
gcgcctgctcccgccccgagcgagagcaagccggccgcccccgccgcagccagcgtccag
gacatcaaggtcccggacatcggctcggccggcaaggccaacgtcatcgaagtgatggtc
aaggccggcgacacggtcgaggccgaccagtcgctgatcaccctggaatccgacaaggcc
agcatggagatcccctcgccggcctccggggtggtggaaagcgtctcgatcaaggtcggt
gacgaagtcggcaccggcgacctgatcctcaagctgaaggtggaaggcgccgctccggca
gccgaagagcaaccggcagccgctccggcccaggccgcggcgcccgccgccgagcagaag
cccgccgcggcggcccctgcgccagccaaggccgataccccggctccggtcggcgcaccc
agccgcgacggcgccaaggtccacgccggcccggcggtgcgcatgctggcgcgcgagttc
ggcgtcgagctgagcgaagtgaaagccagcggtcccaagggtcgcatcctcaaggaagac
gtccaggtcttcgtcaaggagcaactgcagcgcgccaagtccggcggtgccggcgccacc
ggcggagccggcatcccgccgatcccggaagtcgacttcagcaagttcggcgaagtggaa
gaagtggcgatgacccgcctgatgcaggtcggcgccgccaacctgcatcgcagctggctg
aacgtgccgcacgtgacccagttcgaccagtcggacatcaccgacatggaagccttccgc
gttgcccagaaggccgcggcggagaaggccggggtcaagctgaccgtactgccgatcctg
ctcaaggcctgcgcccacctgctcaaggaactgccggacttcaacagttcgctggccccc
agcggcaaggcgctgatccgcaagaagtacgtacacatcggcttcgccgtggacactccg
gacggcctgctggtcccggtgatccgcgatgtcgaccggaagagcctcctgcaactggcc
gccgaggccgccgagctggccgacaaggcccgcaacaagaagctctcggccgatgccatg
cagggcgcctgcttcaccatctccagtctcggccacatcggcggcaccggcttcacgccg
atcgtcaacgcgccggaagtggcgatcctcggtgtgtccaaggcgaccatgcagccggta
tgggacggcaaggccttccagccgcgcctgatgctgccgctgtcgctgtcctacgaccat
cgcgtgatcaacggtgccgccgcggcgcgcttcaccaagcgcctgggcgagctgctggcg
gacatccgcaccctgctcctgtaa

DBGET integrated database retrieval system