KEGG   Pseudomonas aeruginosa LESB58: PLES_55681Help
Entry
PLES_55681        CDS       T00818                                 

Gene name
cysQ
Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pag00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6164012..6164833)
Genome map
AA seq 273 aa AA seqDB search
MRPVPWGELVALVRRAGEAILPHWRADVAVRSKADESPVTAADLSAHHILEAGLRALAPD
IPVLSEEDCEIPLSERGHWRRWWLVDPLDGTKEFISGSEEFTVNVALVEDGRVLFGLVGV
PVSGRCYYGGAGLGAWREEADGRAQPISVRLEPEEAFTVVASKRHGSPAQERLLDGLSER
FGDLRRASIGSSLKFCLLAEGAADCYPRLTPTSQWDTAAAQGVLEGAGGEVLDLHGAPFT
YEPREDYLNGSFLALPRAAEWRSELIQLARALH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggtgccttggggcgaattggtggcgctggtgcggcgcgccggcgaggcgatc
ctgccgcactggcgcgccgacgtggcggtgcgctcgaaggccgacgaatcgccggttacc
gccgccgacctgtccgcgcaccatatattggaggcggggttgcgggcgctggcgccggac
attccggtgctttccgaagaggattgcgagataccgctgagcgagcgcggccactggcgg
cgctggtggctggtggacccgctggacggcaccaaggagttcatctccggtagcgaggag
ttcaccgtcaacgtggccctggtcgaggatggccgggtgctgttcggtctggtcggcgtg
ccggtgagcggccgctgctactacggtggcgccggtctcggtgcctggcgcgaggaggcc
gatggccgcgcgcaaccgatcagtgtgcgcctggagcccgaggaggccttcaccgtggtg
gccagcaagcgccatggcagcccggcccaggagcgcctgctggatggcttgagcgagcgc
ttcggcgacctgcggcgagccagcatcggcagttcgctgaagttctgcctgctggccgag
ggcgctgccgactgctatccgcgcctgacgccaacctcgcaatgggacacggccgccgcc
cagggtgtgctggaaggcgccggcggcgaggtgctcgacctgcatggcgcgccattcacc
tacgagccgcgcgaggactacctcaacggctccttcctggccctgccgcgcgctgctgag
tggcgcagcgagctgatccaactggcgcgcgcgctgcactga

DBGET integrated database retrieval system