KEGG   Pseudomonas aeruginosa LESB58: PLES_55681Help
Entry
PLES_55681        CDS       T00818                                 

Gene name
cysQ
Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PLES_55681 (cysQ)
Enzymes [BR:pag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PLES_55681 (cysQ)
Transfer RNA biogenesis [BR:pag03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PLES_55681 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6164012..6164833)
Genome map
AA seq 273 aa AA seqDB search
MRPVPWGELVALVRRAGEAILPHWRADVAVRSKADESPVTAADLSAHHILEAGLRALAPD
IPVLSEEDCEIPLSERGHWRRWWLVDPLDGTKEFISGSEEFTVNVALVEDGRVLFGLVGV
PVSGRCYYGGAGLGAWREEADGRAQPISVRLEPEEAFTVVASKRHGSPAQERLLDGLSER
FGDLRRASIGSSLKFCLLAEGAADCYPRLTPTSQWDTAAAQGVLEGAGGEVLDLHGAPFT
YEPREDYLNGSFLALPRAAEWRSELIQLARALH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggtgccttggggcgaattggtggcgctggtgcggcgcgccggcgaggcgatc
ctgccgcactggcgcgccgacgtggcggtgcgctcgaaggccgacgaatcgccggttacc
gccgccgacctgtccgcgcaccatatattggaggcggggttgcgggcgctggcgccggac
attccggtgctttccgaagaggattgcgagataccgctgagcgagcgcggccactggcgg
cgctggtggctggtggacccgctggacggcaccaaggagttcatctccggtagcgaggag
ttcaccgtcaacgtggccctggtcgaggatggccgggtgctgttcggtctggtcggcgtg
ccggtgagcggccgctgctactacggtggcgccggtctcggtgcctggcgcgaggaggcc
gatggccgcgcgcaaccgatcagtgtgcgcctggagcccgaggaggccttcaccgtggtg
gccagcaagcgccatggcagcccggcccaggagcgcctgctggatggcttgagcgagcgc
ttcggcgacctgcggcgagccagcatcggcagttcgctgaagttctgcctgctggccgag
ggcgctgccgactgctatccgcgcctgacgccaacctcgcaatgggacacggccgccgcc
cagggtgtgctggaaggcgccggcggcgaggtgctcgacctgcatggcgcgccattcacc
tacgagccgcgcgaggactacctcaacggctccttcctggccctgccgcgcgctgctgag
tggcgcagcgagctgatccaactggcgcgcgcgctgcactga

DBGET integrated database retrieval system