KEGG   Pseudomonas aeruginosa LESB58: PLES_56531Help
Entry
PLES_56531        CDS       T00818                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pag00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(6256670..6257425)
Genome map
AA seq 251 aa AA seqDB search
MSGWRLLLTRPDEECAALAASLGEAGVHSSSLPLLAIDPLEETPEQRTLMLDLDRYCAVV
VVSKPAARLGLERLDRYWPQPPQQTWCSVGAATAAILEAYGLDVTYPEQGDDSEALLALP
AFQDSLRVHDPKVLIMRGEGGREFLAERLRGQGVQVDYLPLYRRRAPDYPAGELLARVRA
ERLNGLVVSSGQGLQNLYQLAAADWPEIGRLPLFVPSPRVAEMARELGAQRVIDCRGASA
PALLAALTSAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggctggcggctcctgctgacgcgccccgacgaggagtgcgcggccctggccgcc
agcctcggcgaggcgggcgtccatagcagcagcctgccgctgttggcgatcgatccgctg
gaagaaaccccggagcagcgtacgctgatgctcgacctggaccgctactgcgcggtggtg
gtggtcagcaagccggcggcgcgcctggggctggagcggctcgaccgctactggccgcag
cctccgcagcagacctggtgcagcgtcggcgcggcgaccgcggcgatcctcgaggcctac
ggcctcgacgtaacctaccctgaacagggcgacgacagcgaagcgttgctggcgctgccg
gcgttccaggattccctgcgcgtgcacgatccgaaagtgctgatcatgcgcggcgaaggt
ggccgagaattcctcgccgagcgcctgcgcggccaaggcgtgcaggtggactacctgcca
ctctaccggcgccgggctccggactatccggccggagagctgctggcaagggtgcgggcg
gaacgcctgaacggcctggtggtcagcagtggacagggtttgcaaaatctgtatcagttg
gcggcagccgattggcccgagataggccggttgccgctgttcgtacccagcccgcgggtc
gccgagatggcgcgcgaactgggtgcgcaacgggtgattgattgccggggcgcgagcgcg
ccggccttgctggcggccctgacgagcgccgcctag

DBGET integrated database retrieval system