KEGG   Pseudomonas aeruginosa LESB58: PLES_57171Help
Entry
PLES_57171        CDS       T00818                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_57171 (algC)
   00030 Pentose phosphate pathway
    PLES_57171 (algC)
   00051 Fructose and mannose metabolism
    PLES_57171 (algC)
   00052 Galactose metabolism
    PLES_57171 (algC)
   00500 Starch and sucrose metabolism
    PLES_57171 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PLES_57171 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PLES_57171 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PLES_57171 (algC)
Enzymes [BR:pag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PLES_57171 (algC)
    5.4.2.8  phosphomannomutase
     PLES_57171 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6328329..6329720
Genome map
AA seq 463 aa AA seqDB search
MSTAKAPTLPASIFRAYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLS
GPELVKQLIQGLVDCGCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIV
VAGETLANEQIQALRERIEKNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCG
NGVAGVIAPQLIEALGCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLA
FDGDGDRVGVVTNTGTIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGR
PVMWKTGHSLIKKKMKETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDS
EHVFSAFPSDISTPEINITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLV
RASNTTPVLVLRFEADTEEELERIKTVFRNQLKAVDSSLPVPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaaaagcaccgacgctgcccgccagcatcttccgcgcctacgacatccgt
ggcgtggtaggcgataccctcaccgccgagaccgcctactggatcggtcgcgccatcggc
tcggaaagcctcgcccgcggcgaaccgtgcgtcgctgtcggccgcgatggccgcctgtcc
ggtcccgagctggtcaagcagctgatccagggcctggtggactgcggttgccaggtcagc
gacgtgggcatggtgcctaccccggtgctgtactacgcggccaacgtgctcgagggcaag
tccggggtgatgctgaccggcagccacaacccgccggactacaacggcttcaagatcgtg
gtcgccggcgagaccctggccaacgagcagatccaggccctgcgcgagcgcatcgagaaa
aacgacctggcatccggcgtcggcagcgtagagcaggtcgacatcctgccgcgctacttc
aagcagatccgcgacgacatcgccatggccaagccgatgaaggtggtggtcgactgcggc
aacggcgtggccggggtgatcgccccgcagttgatcgaggccctgggctgcagcgtgatc
ccgctgtactgcgaggtcgacggcaacttcccgaaccaccatccggacccgggcaagccg
gagaacctgaaggacctgatcgccaaggtcaaggccgagaacgccgacctgggcctggcc
ttcgacggcgacggcgatcgcgtcggcgtggtcaccaataccggtaccatcatctatccg
gaccgtctgctgatgctgttcgccaaggacgtggtctcgcgcaacccgggggccgacatc
atcttcgacgtcaagtgcacccgccgtctgatcgccctgatcagcggctacggcggccgt
ccggtgatgtggaagaccggccactcgctgatcaagaagaagatgaaggaaaccggcgcc
ctgctggctggcgagatgagcggccacgtgttcttcaaggagcgctggttcggcttcgac
gatggcatctacagcgccgcccgcctgctggaaatcctcagccaggatcagcgtgacagc
gagcacgtgttctcggccttcccgagcgacatttccaccccggaaatcaacatcaccgtc
accgaggacagcaagttcgccatcatcgaggcgctgcaacgcgacgcccaatggggcgaa
ggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaaggctggggcctggta
cgcgcctccaacaccactcccgtgctggtcctgcgcttcgaagcggacaccgaggaagag
ctggagcgcatcaagaccgtcttccgtaaccaactgaaggcagtggattcctcgctgccc
gtgcccttctga

DBGET integrated database retrieval system