KEGG   Pseudomonas aeruginosa LESB58: PLES_58171Help
Entry
PLES_58171        CDS       T00818                                 

Definition
putative aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_58171
Enzymes [BR:pag01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PLES_58171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6439090..6440046
Genome map
AA seq 318 aa AA seqDB search
MILLPSIRLPETAMNTDSPINRVEQVQVDDLACWRIHTAHGEALIAQQGAQLLSYQPHEQ
PPLVWLSDEAGYRRGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDW
EIDDIAEEDGDLCVSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLS
QALHTYFAVSDSREIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLI
KDPRWERSIHLHALDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAP
GRSESFGVQIWSEPLKRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgatactgctgccatccattcgcctcccggagaccgccatgaacaccgatagcccgatc
aaccgcgtcgaacaggtacaggtcgacgacctggcctgctggcgcatccacaccgcccat
ggcgaggcgctgatcgcccagcagggcgcgcaactgctcagctaccagccccacgaacag
ccgccgctggtctggctcagcgacgaggccggctaccggcgcgggcagtcggtacgcggc
ggggtgccggtgtgctggccgtggttcggtccgctggagcgcaacccgcaggaagtccgc
ggccaggtggaagatggcctgaaggcgcccgcccacgggctggtccgggcagtcgactgg
gaaatcgacgacatcgccgaggaggacggcgacctctgcgtcagcttccgcctcgacgcc
cccgatggcctccccggctggccgcacccggcggcgctgcgcatgctgttccgcttcggc
gagcgcctgaccctgcgactcaccagcgagaacctcggcagcaagccgctggtgctcagc
caggcactgcacacctacttcgcggtcagcgacagccgcgagatcgccatcgagggcctg
gaaggcgcgcgctacatcgagaccctggagaactgggaagaacgcactcagcacggcgcg
gtacgggtcaagggcgaactggatcgcatctacctcggtctcgaacgcgacctgctgatc
aaggacccgcgctgggaacgcagcatccacctgcacgccctcgactcgcgctcggcggtg
gtctggaacccctgggtggacaagtcccggcgtctctcacagttcgccgacgacgcctgg
cagcagatgctctgcatcgagaccgggcgggtctgggacgacctcatggtggtcgccccc
gggcgcagcgaaagctttggcgtgcagatctggagcgagccgctgaaacgaccctga

DBGET integrated database retrieval system