KEGG   Pseudomonas aeruginosa LESB58: PLES_58221Help
Entry
PLES_58221        CDS       T00818                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PLES_58221 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_58221 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PLES_58221 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PLES_58221 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PLES_58221 (adhA)
   00626 Naphthalene degradation
    PLES_58221 (adhA)
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PLES_58221 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6443034..6444062
Genome map
AA seq 342 aa AA seqDB search
MTLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPP
LPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGY
SVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIG
GLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEVLQRDIGGAHGV
LVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQE
ALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccacagaccatgaaagccgcggtcgtgcacgcctacggcgcgccgctgcgg
atcgaggaagtcaaggttccgctgcccggccccgggcaggtactggtgaagatcgaagcc
tccggcgtctgccacaccgacctgcatgccgccgagggcgactggccggtgaagccgccg
ttgccgttcattcccggtcacgaaggcgtcggctacgtcgccgcggtgggcagcggagtg
acccgagtgaaggaaggcgaccgggtcggcatcccctggctgtacaccgcctgcggctgc
tgcgagcactgcctgaccggctgggagaccctctgcgagagccagcagaacaccggctac
tcggtgaacggcggctatgccgaatacgtattggccgacccgaactacgtcggaattctg
ccgaaaaacgtcgaattcgctgaaatcgcgccgatcctctgcgccggcgtcaccgtctac
aaggggctcaagcagaccaacgcgcgccccggccagtgggtggcgatctccggcatcggt
ggcctcggccacgtcgccgtgcagtacgccagggccatgggcctgcacgtcgccgccatc
gacatcgacgacgccaagctggaactggcgcgcaagctcggtgccagcctgacggtcaac
gcccggcaggaagacccggtggaggtgctccagcgcgacatcggcggcgcccacggggtg
ctggtcaccgcggtatccaacagcgccttcggccaggccatcggcatggcgcgccgcggc
ggcaccatcgccctggtcggcctgccgccgggtgacttcccgacgccgatcttcgacgtg
gtgctcaagggcctgcacatcgccggctccatcgtcggcacccgcgcggaccttcaggaa
gccctcgactttgccggcgaaggcctggtcaaggcgaccatccatccgggcaagctggac
gacatcaaccagatcctcgaccagatgcgcgccgggcagatcgaggggcgcatcgtcctc
gagatgtga

DBGET integrated database retrieval system