KEGG   Pseudomonas aeruginosa LESB58: PLES_58831Help
Entry
PLES_58831        CDS       T00818                                 

Definition
putative GGDEF domain protein
Orthology
K13590  
diguanylate cyclase
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6513951..6515966)
Genome map
AA seq 671 aa AA seqDB search
MSRDDVQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDQCMKELR
EILRRDDMDAGLSGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALDLPRELRKP
LKQFARDIEERARQSREIPILLSELSRLQRQALAERKGGDAEDGRPSLLQRLFGGKESET
TAEPSASVPSVVAASNTPIQPAAAAPSLPVAEHDEAPGGPPQPLPARTVAAIESAPAGWV
GVAERGEPNQILLDEPREIWLDSLPLPAGLSFSETLEEAGAEPSPAMPADVESAPEAPAT
PVDNLDGQAVDEAYELPPPIPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRERI
DGSLNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTDVL
DNARGFDQSLREQVSGLQASVQQATDLNSLKLAVDSRLNGLLASMDEHQREQAEHEQEVS
GRLQALMERVNSMEQDAKAFHSHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRHRDG
GDLLLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPA
TSLEAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFEGNEAGEAVFERADQALYRA
KRAGRDRLEVA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgacgacgtccagcgctggaaagacaagtacctggagaacatcgagcagcag
gagcgcctgcaacggcgctgggatgcccggatcgacctgctgcgtcgcggcctggtgcgt
agcagtctggcggccgaaggcagcgacaaggcggtcgaccagtgcatgaaggagctgcgc
gagatcctccgtcgcgacgacatggacgccggcctgtcgggcctgattccgcgcctggaa
aaggccgtgctcgactccgaacagcgccgccagcaacgcacccagcagaacatcgatgct
ctcggcgaactggcccagcagttgctggccctggacctgccgcgggaactgcgcaagccg
ctgaagcagttcgcccgcgatatcgaggagcgcgcccggcagtcgcgcgagattccgatc
ctgctcagcgagctgagcaggctgcaacgccaggcgctggccgagcgcaagggcggcgat
gccgaagacggtcgcccgagcctgttgcaacgcctgttcggcggcaaggagtcggaaacc
accgcggagccgagcgcatcggtgccgtccgttgtggcggcaagcaatacaccgatccaa
ccggcggcggccgcgccgtccctgccggtcgccgagcacgacgaggcgccaggcggtccg
ccgcagccgttgcccgcccgcacggtcgccgccatcgaaagcgcgccagcgggttgggtc
ggggtcgccgagcgtggcgagccgaaccagatcctgctggatgagccccgggaaatctgg
ctcgacagcctgccgctaccggccggcctgagctttagcgagacgctggaagaagcgggt
gcggagccgtcgcccgcaatgccggcggacgttgaaagcgcgcccgaagctccggccact
cctgtggataacctcgacgggcaggcggtagacgaggcctacgaactgccgccgccgata
ccggagcccggctacagcgcggtggcgccgcacatcgaggccagcctgctgcggctgctc
gacggcctgtccctgccgagcagccaccagccccaggccgaggcgctgcgggagcggatc
gatggcagcctgaactggtatgagctggtgccggtactcgacgacctggcggtgctggtg
ctgtccctggcggacagtggccagcgcgacttcgaggaatacctgcggcaactcaacgag
cgcctggaaagcttcctcggccacctgggcgacgcccacgccggctataccgacgtgctg
gacaacgcgcgcggcttcgaccaatcgctgcgtgagcaggtcagtggcctgcaggccagc
gtgcagcaggcgaccgacctgaacagcctcaagctggcggtggacagccggctgaacggc
ctgcttgcctccatggacgaacaccagcgcgaacaggccgagcacgaacaggaggtgtcc
ggccgcctgcaggcgctgatggagcgggtcaacagcatggagcaggatgccaaggcgttc
cacagccacctggaggaccagcgacagaaagccctgaccgatccgctgaccggcctgccc
aaccgcgcggcgctcagcgagcgcctggaacaggaagtggcgcgccggcaccgggacggc
ggcgatctgctgctggcggtgctggacatcgaccacttcaagcggatcaacgacgacttc
ggccacctggccggggacaaggtgctgaagatcattgccggcgaattgcgcaaacggttg
cggcaggccgatttcatcgcccgtttcggcggcgaggagttcgtcgtcctgctcccggcc
acgtccctggaagccggccggcaactgctcgaacggctgcgcgcggcgatcgccgcctgt
ccgttccatttcaagggcgagcccctgagcatcacctgttccgccggcatcaccgcgttc
gaaggcaacgaggccggcgaagcggttttcgagcgtgccgaccaggcgctgtatcgagcc
aagcgcgccggccgggaccgcctggaagtggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system