KEGG   Porphyromonas asaccharolytica: Poras_0334Help
Entry
Poras_0334        CDS       T01485                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
pah  Porphyromonas asaccharolytica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pah00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Poras_0334
DNA repair and recombination proteins [BR:pah03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Poras_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(411167..411784)
Genome map
AA seq 205 aa AA seqDB search
MKDQYPSQWLERAVDQLSLLPGIGRKTAMRMALHLLRQPPSYAQHLGEAIIDLRQKICYC
ERCHCISDSPLCDICSDPQRDQSVVCVVEQVKDVLTIEQTHRYKGLYHVLGGIISPIDGI
TPNDLEIESLYERVQEEPIREVILAIRSTLEGDTTNYYIYKRLESTGVLVSLIARGISIG
DEIEYADEVTLGSAIANRTPFDQVK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcagtacccctcccaatggctcgagcgcgccgtagatcagctctccctactc
cctggcatagggcgcaagactgcgatgcggatggcgctgcacttgcttcgtcagccgccc
tcctatgcgcagcatctcggggaggcgatcatagaccttcgccagaagatctgctactgc
gagcggtgccactgcatcagcgacagcccgctatgcgacatatgctccgatccacagcgg
gatcagagcgtcgtctgcgtcgtcgagcaggtgaaggatgtcctaaccatcgagcagacg
caccgctacaaaggactgtaccacgtcttgggcggaatcatctctccgatagacggcatc
acaccaaacgatctagagatcgagtcgctctacgagcgtgttcaggaggagcctatccgt
gaggtgatcctcgctatacgctcgaccctagagggcgacacgaccaactactatatatac
aagcgcctggaatctacgggcgtgctggtttcgctcatcgcacgaggtatctcgatcggt
gatgagatcgagtatgctgacgaggtgacgctcgggagcgctatcgcgaatcgtaccccc
tttgaccaagtgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system