KEGG   Porphyromonas asaccharolytica: Poras_0443Help
Entry
Poras_0443        CDS       T01485                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18119  
succinate-semialdehyde dehydrogenase [EC:1.2.1.76]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Poras_0443
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Poras_0443
Enzymes [BR:pah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.76  succinate-semialdehyde dehydrogenase (acylating)
     Poras_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537197..538555)
Genome map
AA seq 452 aa AA seqDB search
MDIKEMVSLAREAQKDYQARFDQDAVDQVVKALCRVVYDNAEMLAREAVDETEMGVYEDK
VAKCRNKSKGVWSNLQGKKSMGVLDIDEKTGLIKIAKPVGVVAAITPTTNPIVTPMANIA
FALKTRNAIIVSPHPRSKNCSAHTIQLILERLKEFNVPEHLIQCVTEPSIQATQDLMAAV
DVVVATGGMGMVHSAYSSGKPSFGVGAGNVQVILDEHIDYKEAAETIIRGRIFDNGIICS
GEQCFIYPEQHREEIFQAFKDHGAYFVPAEEHDKLVNTLFVNGTISRDVVGKSVQHIAQL
AGISVPEGTRMLIVPAKGVGTADPICKEKMCPVMTCLPYKHFDEAIEIANTNLKMEGSGH
TAGIHSNNQGNIIKAGDEITISRLIVNAPCSITAGGSIQNGLSVTTTLGCGSWGNNSISE
NLTYKHLLNISRIARMSPHVHVPTDEEIWAMN
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaagaaatggtctctctagcacgagaggcacagaaggattaccaagcacgc
ttcgatcaggacgctgtagaccaggtggtcaaggctctctgtcgtgtcgtctatgacaat
gctgagatgctcgctcgtgaagctgtcgacgagaccgagatgggcgtctatgaggacaaa
gtagctaagtgccgcaacaagtcaaaaggcgtatggagcaacctccagggcaagaagagt
atgggcgtactggacatcgacgagaagaccggcctcatcaagatcgctaagcccgtaggt
gtcgtcgctgcgatcactccgacgactaatccgatcgtcactccgatggcaaacatcgcc
ttcgctctcaagacacgcaacgcgatcatcgtctcgccacacccacgctctaagaactgc
tccgcacataccatccagctcatactggagcgtcttaaggagttcaacgtacctgagcac
ctcattcagtgcgtcaccgagccctctatccaagccacgcaagaccttatggcggctgtc
gacgtcgtagttgctacgggtggtatgggcatggtacactctgcttactcttcgggcaag
ccctcctttggcgtaggcgctggcaacgtgcaggtcatcctcgatgagcatatcgactac
aaagaagctgccgagaccatcatccgtggacgtatctttgacaacggcatcatctgctct
ggcgagcagtgcttcatctaccctgagcagcaccgggaggagatcttccaggccttcaag
gatcacggagcttacttcgtaccagctgaggagcacgacaagctggtcaatacgctcttc
gtcaacggcaccatcagccgtgacgtcgtcggcaagagcgtgcagcacattgctcagctc
gctggtatctccgtacccgaggggacccgtatgctcatcgtccctgccaagggcgtcggc
acggccgatcctatctgcaaggagaagatgtgtcccgtgatgacctgcctgccttacaag
cactttgacgaggctattgagattgccaataccaacctcaagatggagggtagtggccac
acggcaggtatccactcaaacaatcagggtaacatcatcaaggctggcgatgagatcact
atctcgcgtctgatcgtcaatgcgccttgctcgatcacggctggtggatcgatccaaaac
ggtctctccgtgactacaaccctaggctgcggtagctggggcaataactctatctcggag
aaccttacctacaagcacctactcaacatctctcgcatcgctcgcatgtcgccacacgtc
cacgtgccgaccgacgaggagatctgggcgatgaactaa

DBGET integrated database retrieval system