KEGG   Porphyromonas asaccharolytica: Poras_0491Help
Entry
Poras_0491        CDS       T01485                                 

Definition
hypothetical protein
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pah01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pah00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592215..592952
Genome map
AA seq 245 aa AA seqDB search
MNYHQYSTPELVTTQLAQFIAEAVEATEGDFHLALSLEEHAEVLAQALTSEPWRSRIAWD
RVHFYLLHEQLGEADLAHRTLLQRLLFDPLQIPAEHIHAVEESAQEPAQAAASLQQHVAE
RVSHLDGRPQFDLALLEMGVDGHLAGVYPDQVELYISDDVFAPNEMTTEQGEQRQLVTVT
LEALEESKRLVFLALGQDVRHAVGHIVNLLPEAKAYPANFLAAKIPWVHLFADDQAMREK
SYAIY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcatcaatacagtacccccgagctagtcacgacacagctcgcacagtttatt
gccgaagcggtcgaggcgaccgaaggcgactttcatctagcactctcattggaagagcat
gcggaggtcttggcacaggcactcacgtcagagccttggcgtagtcgtatcgcatgggat
cgagtacacttctacctacttcacgagcagctgggcgaagccgatctagcgcatcgcacg
ctgctacagcgtctgctattcgatccgctacagatccctgcggagcatatccacgctgtg
gaggagtctgcacaagagcccgcacaggctgcggcctctctgcagcagcatgtagcggag
cgtgtaagccatctagacggtcgtccgcagtttgacctagccctcctcgagatgggtgtg
gatggtcacctcgctggggtctatcccgaccaggtggagctgtatatctcggacgacgtc
tttgcacccaatgagatgaccaccgagcaaggggagcagcgtcagctggttacggtcacg
ctcgaggcacttgaagagtctaagcgactggtcttcctcgcactcggtcaggacgtgcgc
cacgcggtgggacacatcgtcaatctcttgcccgaggcgaaagcttatcctgctaacttc
ctcgcggcgaagataccttgggtacatctctttgccgatgatcaggccatgcgtgagaag
tcttacgcgatctattaa

DBGET integrated database retrieval system