KEGG   Porphyromonas asaccharolytica: Poras_0535Help
Entry
Poras_0535        CDS       T01485                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Poras_0535
Enzymes [BR:pah01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Poras_0535
Exosome [BR:pah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Poras_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
657587..659629
Genome map
AA seq 680 aa AA seqDB search
MKREKGTPRQVKPKQITPLWAQQDPWLAPYYETIAAWQSYIAARRQLLVGSQSLSSWACG
HLYFGLHRTESGWTLREYAPAAKAVYLLCDANQWRQDPIYRYVANEERPGEWLLKLPATA
LHHLDYYKLLICTDDEELERIPAYAHYVVQDPRDYSFCARVWAPEEPYLMQAPAPERPDT
LLIYECHIGMSGEEMGVASYEQFRTERLPYIVSAGYNTLQIMAVQEHPYYGSYGYHVSNF
FAPSSRFGTPDDLKRLVDEAHALGLYVIMDLVHSHAVRNEAEGLARYDGTRTLFFHEGSR
GEHPQWDSLCFDYGPGEVVHYLLSNCHYWLTEYGFDGFRFDGVTSMLYEDHGLGRPFLTY
EDYYNGHVDRDALTYLTLANELIHAVKPAATTIAEEVSGLPGLCESQASDGYGFDYRLAM
NVPDYWIKLIKEQPDEAWNPENMWYELRNHRPTERTISYAESHDQALVGDKTIIFRLIDS
DMYWHMQQSDYNDRVMRGIALCNMIRLMTFATMCGGYLTFMGNEFGHPEWIDFPREGNGY
SYQYARRQWSLRDNDLLRYKQLAHFDKGMLSLCSLTPRFAELSDYCYHSHTERQVIVFMR
GDGYLFAFNFSPTESYVDYPIEGVPAGQYMLLLDSDAVACGGFGRIDASVTHHTRTTAEG
GTELRLYLPSRSAQVYSHKP
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgagaaaggcactcctcgccaagtgaagccaaagcagatcacaccgctctgg
gcacagcaagacccgtggctcgcgccctactatgagacgatcgctgcgtggcaaagctat
atcgcagcgcgtcggcagctgcttgtcggctcgcagagcctctcgagctgggcgtgtgga
cacctttactttgggctgcatcgcacagagtcggggtggacactgcgtgaatatgcgcca
gcagctaaggcagtctacctactttgcgacgctaaccagtggcgtcaagatccgatctat
cgatatgttgctaatgaggagcggccaggtgagtggctcctcaagctacccgccacagcg
ctgcaccatctggactactacaagctccttatctgcaccgacgatgaggagctagagcgt
atccccgcttacgcacattatgtggtgcaggatccgcgtgactacagcttctgcgctcga
gtctgggcacccgaagagccttacctgatgcaggcgccagcacctgaacgtcccgacacc
ttgctcatctatgagtgccacatagggatgagtggcgaggagatgggcgtggcgagctac
gagcagtttcgcacggagcgactgccctacatcgtctcggcgggctacaacacgctccag
atcatggcggtgcaggagcacccgtactacggttcgtacggctatcacgtctccaacttc
tttgctccgtccagtcgcttcggtacgcccgacgacctcaagcgcctggtcgatgaggcg
cacgctttgggcctttacgtcattatggacttagttcactcgcatgccgtgcgcaacgaa
gctgagggcttggctcgctacgacggcacgcggacgctcttctttcacgaggggagccga
ggggagcacccgcagtgggactcgctctgctttgattacggccctggcgaggtggtccac
tacctcctctccaattgccactactggctcacggagtatggcttcgatggcttccgcttc
gacggggtcacctcaatgctttacgaggatcacggcttggggagacctttcctcacctat
gaggactactataatggccatgtagaccgagatgcgctgacctatctgacgctcgccaac
gagctgatccacgctgtcaagcccgcagcgactaccatcgccgaggaggtgagcggactg
ccgggactgtgcgagagccaagcctccgatgggtacggctttgactaccgactggcgatg
aatgtgccagactactggatcaagctgatcaaagagcagcccgacgaagcgtggaatccg
gagaatatgtggtacgaactgcgcaatcaccgtcctacggagcgaacgatctcctacgct
gagagccatgatcaggcactcgtcggagacaagaccatcatcttccgactcatcgacagc
gatatgtactggcatatgcagcagagcgactacaacgatcgggtgatgcgtggcatagcg
ctctgcaatatgatccgtctgatgaccttcgccacgatgtgtggcggttatctcaccttt
atgggcaatgagtttggtcaccccgagtggattgacttccctcgtgagggcaatggttac
tcttaccagtacgctcgtcgtcagtggtcactgcgggacaatgacttactgcgctacaag
cagctagcgcactttgacaaagggatgctctcgctctgtagcttgacgccccgctttgca
gagctctcggactactgctaccacagtcacacggagcgacaggttatcgtcttcatgcgg
ggtgacggctacctctttgccttcaactttagccccacggagagctacgtcgactatccc
atagagggcgtgcccgcgggacagtatatgctactcctcgacagcgatgcggtcgcctgc
ggaggcttcggacgtatcgatgccagtgtcacgcatcacacccgcaccaccgccgagggt
ggcaccgagctacgactctatctgccctcccgctcagcgcaagtctacagccacaagccg
taa

DBGET integrated database retrieval system