KEGG   Porphyromonas asaccharolytica: Poras_0592Help
Entry
Poras_0592        CDS       T01485                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Poras_0592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Poras_0592
   00052 Galactose metabolism
    Poras_0592
   00500 Starch and sucrose metabolism
    Poras_0592
   00520 Amino sugar and nucleotide sugar metabolism
    Poras_0592
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Poras_0592
   00524 Butirosin and neomycin biosynthesis
    Poras_0592
Enzymes [BR:pah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Poras_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720538..721506)
Genome map
AA seq 322 aa AA seqDB search
MSLYLGIDIGGTNTELGIVDEEGQIVSSQTLSTKQCGSLFSDYIEALSQQIAQMIANPAL
TDRVVGIGIGAPNANYFSGCIEEAVNLPWTGNTPIVADLSARTGLPVVLDNDANASALGE
HSYGVARELDHFVEITLGTGVGSGIYADGRLIRGYQGKAGELGHMAVGEPHQRCGCGRYG
CLEASVAAPAVARRAVSLKKLCLEQGMWSELCDIPDEELTSKTVAEVALATGDSLARQVF
EETGEILGRALAQFACFSAPQAFVLFGGVARCGDLLLQPARKAFDEALLHIYRGSIEILL
SSLPKGQAAVLGAASLARERAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcactatacttaggcatagacataggtggaaccaacacagagctaggcatcgtcgat
gaggagggacaaatagtctcctcgcagacgctctcgacgaaacaatgcggaagcctcttc
tctgactacatcgaggcgttgagccagcagatagcgcaaatgatcgctaacccagcacta
acagatcgggtcgtcggcataggcatcggagcgccgaatgccaactacttctcaggttgt
atcgaagaggcggtcaacctcccctggactggcaacacgcctatcgttgctgatctctcg
gctcgtacaggactacccgtcgtcctagacaacgatgccaatgcgagtgcgctcggcgag
catagctacggcgtggctcgtgagctagaccacttcgtcgagataaccctaggcacagga
gtaggtagcggtatctatgccgatggtcgtctcatacgaggttaccaaggcaaggcgggc
gagctgggacacatggctgtgggtgagcctcatcagcgctgtggctgtggacgatacggg
tgtctcgaggcttctgtcgcagcaccagccgtggcgcggcgtgccgtgagccttaagaag
ctctgtctagagcaaggcatgtggagcgaactctgtgatatacctgatgaagagctaacc
agcaagactgtagcagaggtagctctagcgacaggcgactcattagctcgacaagtcttc
gaggagacgggagagatattgggacgcgccttggcgcagttcgcttgcttctcagcacca
caagcattcgttctcttcggcggcgtagcacggtgtggtgacctgctcctgcaaccggcg
cgcaaagcctttgacgaagcactactccacatctacagaggctctatcgagatcctcctc
agctcactccctaagggacaagctgccgtactaggtgctgcctcactagcccgcgaacga
gccctataa

DBGET integrated database retrieval system