KEGG   Porphyromonas asaccharolytica: Poras_0909Help
Entry
Poras_0909        CDS       T01485                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pah00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pah00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1140774..1141259
Genome map
AA seq 161 aa AA seqDB search
MATIYDFTALTSQGKELNLADLRGKVILIVNTASKCGYTPQLAGLEELHKQYHDKGLVLL
GFPCNQFGGQDPGTDEEIRDFCQVNYGVTFQIMQKVEVNGPHAHPLFKFLKEETSQDSDL
PVKPIQWNFNKFLISRDGTDITRYGSAKLPKNLAKDIEALL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcaactatatacgacttcaccgccctgacctctcagggcaaggagctaaacttagcc
gacctacgcggcaaagtcatcctcatcgtcaataccgcgagcaagtgcggctacacgcct
cagctggctgggctcgaggagctacacaagcagtaccacgacaaggggctcgtcctgctc
ggcttcccttgcaatcagtttggcgggcaagaccctggcaccgatgaggagatacgagac
ttctgtcaggtcaactatggcgtcaccttccaaatcatgcagaaggtagaggtcaacggg
ccccacgcccacccgctctttaagttcctcaaggaggagacgagccaagactcagacctg
ccagtcaagccgatacagtggaacttcaacaagttcctcatctcccgtgacggcaccgac
ataacccgctacggatcggctaagctacctaagaacttagccaaggacatcgaagctctc
ctctaa

DBGET integrated database retrieval system