KEGG   Porphyromonas asaccharolytica: Poras_0931Help
Entry
Poras_0931        CDS       T01485                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Poras_0931
Enzymes [BR:pah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Poras_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172404..1172784)
Genome map
AA seq 126 aa AA seqDB search
MKNKAIISIGSNEHRTANVKEVMEILTKHFPTIRFSTPQLTEPMDMPEDAKAFLNLIALF
ETDLDRETLEAKLKKLETKLGRDHDDDEEGIIPMDLDIIEWNDEVYKPQDMVRPYVVAGL
EELDEL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagcgatcatcagcataggcagtaatgagcatcgcacggccaacgttaag
gaggttatggagatactcacgaagcacttccccacgatacgcttttcgacgcctcagctc
acggagcctatggatatgcccgaggatgctaaggcttttctcaatctgatcgcgctcttt
gagaccgacctagatagagagactctagaggctaagctaaagaagctagagactaagctc
ggacgtgaccacgatgacgacgaagagggtatcataccgatggatctagacatcatcgag
tggaacgatgaggtctacaagccacaagatatggtccgcccctatgtcgtcgcaggacta
gaagagctagatgagttgtag

DBGET integrated database retrieval system