KEGG   Porphyromonas asaccharolytica: Poras_0973Help
Entry
Poras_0973        CDS       T01485                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pah00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221770..1223584
Genome map
AA seq 604 aa AA seqDB search
MEAFSRLAGVAIPLFSLRRHGDAGCGDFAALEAFAPVAERMGMSIIQLLPLEDTTLYGDS
RDSYPYRPIASTVLNPIYIAVDQLPPLADQQLEQELRAEAERLSAQKTFDYTQVWQLKRR
WLWASFTEQADASRYFTDMINRYARLTLRYAPFKSTPIWHYWVCERMILDLFPDLDREEW
DFWDAMKRVDELEQENKQLVVRTGNFYVYCYMVAQRQMRRAVATIRQHGLALMGDLPVGV
DPHAADTLAYPAQFNKRLSCGAPPDYFSPDGQNWGIVTCRRNWKTLWRERFDYLDRFYDY
LRVDHVLGFFRIWSIPRDGRSGMLGYFLPSRRYLKREIARLGLAETLRPEWIAPTKNPAT
TQVLWIERLDGGYVPRYDVASAAPFATLSPDLQERMRAVCEEYYYSANEELWRERGLERL
SFMQKLTSIHLCAEDLGMVPQCVYPVLEELGILKLYVERMPKSAGIEFEAAPYFSEDSVA
TTSTHDCAPLRLWWAEDAARSRRYYDYFLADYGVSYDTTLTPELAEIIVRRHLESPSRLC
ILPLQDWLALSPEHCATVDPHSEQINDPSNPHHVWSYRMPIRVEELPDDWIRQLRQMISE
THRL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattctcccgtctagctggggtggccatccccctctttagtctgcgtcgccac
ggcgatgcgggctgtggtgactttgccgctctggaggcgtttgcgccagtggcggagcgg
atggggatgagcatcatacagttgctcccgctggaagacaccaccctctatggggatagt
cgtgactcctatccctatcggccgatagcctctacggtactcaatcctatctacatagcg
gtagatcagttgcccccgcttgcggatcagcagctggagcaggagctacgtgcggaggct
gagcggctgagtgctcaaaagaccttcgactatacgcaggtgtggcaactcaagcgacgc
tggctgtgggcctcctttacggagcaggcggacgcttcgcggtacttcaccgatatgatc
aatcgctatgcccggctgacgcttaggtatgctccttttaagagtacccctatctggcac
tactgggtttgcgagcgaatgattctagacctatttcccgatttagatcgtgaggagtgg
gacttttgggatgcgatgaagcgggttgatgagctggaacaggaaaacaaacagctggtc
gtccgtacgggcaacttctatgtctactgctacatggtggcgcagcgacaaatgcgccgt
gccgtagccacgattcgtcagcatgggctggcgctcatgggcgatctgcccgtgggggta
gatccgcatgcagcggacacgcttgcttacccggcccaatttaacaagcgactctcttgc
ggagctcctcccgactacttctctccagatgggcagaactggggtatcgtaacctgtcgc
aggaattggaaaacgctatggcgtgagcgctttgactatctagatcgcttctatgactac
ctgcgcgtggatcatgtgctgggtttcttccgcatctggtccataccacgtgacgggcgc
tctgggatgctgggctactttcttccctcacgacgctacttgaagcgggagatcgccagg
ctagggctggccgagacgctacgaccggagtggatagcgccgaccaaaaatcctgcaacg
acgcaggtcctttggatcgaacgtctcgatggcggctacgtgccgcgctacgacgtggcg
agtgctgcgccctttgcgacgctgtcgcccgatctgcaggagcgtatgcgggctgtctgc
gaagagtactattatagtgccaatgaggagctatggcgcgagcgtggactggagcgtcta
tccttcatgcagaagctcacgagcatccatctctgtgctgaggatctggggatggtgcct
cagtgtgtctaccccgtcctagaggagctgggcatcctcaagctgtatgtggagcgcatg
cctaagagtgccggcatcgagtttgaggcggctccctacttctccgaggatagtgtcgcc
acgacctcgacgcacgactgtgcgccactacgcctctggtgggcggaagatgctgcgcgg
tcacgtcgctattacgactacttcctcgctgattacggcgtctcctacgacaccacgctc
acgcctgagctggcagagatcatcgtacgccggcacttagagagtccctcacgactctgc
atactgccgctgcaagattggctagccctgagccctgagcactgcgccacggtcgatcct
catagcgagcagattaatgatcctagcaatccccatcatgtctggagctatcgtatgcct
atccgtgtcgaggagctccctgacgactggatacgacagcttcgacagatgatctcagag
actcatcggctgtaa

DBGET integrated database retrieval system