KEGG   Porphyromonas asaccharolytica: Poras_1134Help
Entry
Poras_1134        CDS       T01485                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Poras_1134
   01230 Biosynthesis of amino acids
    Poras_1134
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Poras_1134
   00030 Pentose phosphate pathway
    Poras_1134
   00051 Fructose and mannose metabolism
    Poras_1134
   00052 Galactose metabolism
    Poras_1134
  Energy metabolism
   00680 Methane metabolism
    Poras_1134
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Poras_1134
Enzymes [BR:pah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Poras_1134
Protein phosphatases and associated proteins [BR:pah01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Poras_1134
Messenger RNA biogenesis [BR:pah03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Poras_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1456270..1457253)
Genome map
AA seq 327 aa AA seqDB search
MNRIKRIGVLTSGGDAPGMNAAIRAVARASLYHGISVCGIIKGYTGLIENNIIELTVENV
SNIIQRGGTILKTARSHEFETPEGRARAYQVIQENEIDGLVVIGGDGSLTGARLLANEHN
LPIVGIPATIDNDLAGTDLTIGYTTALNTIMDAVDKLRDTASSHERIFFVEVMGRESGFL
ALNGAIATGSEGALIPEDPTSTESLKKMIESGFRKTKSSSIILVTESGEREGQTLFIADD
FKRRYPNFDIRVTILGHLQRGGIPCATDRIMGSRMGAAAVQALLDEQRNVMIGYDNDEIV
YVPFVKATKKQKRIDPDLIDLLHMLSI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcatcaaacgcattggcgtactcacttcgggcggtgatgcccctggcatgaac
gcagctatacgggccgtcgctagagcctctctgtatcacggcatctccgtatgtggcatc
ataaagggctatacaggacttatcgaaaacaatatcatcgagctcaccgtcgagaacgta
agcaatatcatacagcgtggaggcactatcctcaagacagcacgaagccatgaatttgag
actcccgaaggtcgtgctcgtgcctaccaagttatccaggagaatgagatagatggtctc
gttgtcatcggaggtgacggctctctcacgggcgcacgactcctagccaatgagcacaac
ctacccattgtaggcatccctgccaccattgacaatgacctcgcaggcaccgacctcacg
ataggttatacgacagctctcaacaccattatggatgctgtcgacaaactaagagacaca
gcctcaagccatgagcgcatcttctttgttgaggtgatgggacgtgagtctggattcttg
gcactcaatggtgccattgctactggatcagaaggagctctaatccccgaagacccaacc
agtaccgagtccctcaagaagatgatcgagagtggcttccgcaagaccaagagtagtagc
atcatcctcgtcactgagagcggtgaacgcgaggggcaaacactcttcatcgcagatgac
ttcaagcgtcgctaccccaactttgacattcgtgtcaccatcttagggcacctacagaga
ggtggtataccgtgcgctaccgaccgcatcatgggtagtcgtatgggcgccgctgccgta
caggcactcctcgatgagcagcgcaatgtaatgatcggctatgacaacgatgagatcgtc
tacgtcccatttgtcaaggcgacaaaaaagcaaaaacgcatcgacccagacctcatcgac
ttgctacatatgctctctatctaa

DBGET integrated database retrieval system