KEGG   Porphyromonas asaccharolytica: Poras_1140Help
Entry
Poras_1140        CDS       T01485                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:pah01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pah01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pah00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pah00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460861..1461625)
Genome map
AA seq 254 aa AA seqDB search
MDKRTLIVAGNWKMNMTLDAGLRLITDIKEQVAKLSNPCKVILAPPYIHLGAMKGLLAGS
DIEYAAQDCSAHDAGAYTGEVSAEMIRSCGCTYVIIGHSERRAYHKESAELLAQKIDQAL
AHGLKVIFCVGEQQAEREGNRYFEVVDEQLRGSLGHLSHEQMEQIVIAYEPVWAIGTGLT
ATPDQAQEMHQHIRQTVASLFDQKLADLTTILYGGSCKASNAESLFSQPDVDGGLIGGAA
LKADTFLPIITANK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggacaagagaacactcatcgtagccgggaactggaaaatgaacatgaccctggacgcc
gggctccgactcatcacggacatcaaagagcaggtggcaaagctcagcaacccttgtaag
gttatcctagctcctccctacattcacctaggtgcgatgaagggactactcgctgggagc
gacatcgagtatgctgcacaggactgctcagcacacgatgctggagcttacacaggtgag
gtatctgctgagatgatacgttcctgcggctgcacctacgtcatcatcgggcacagtgag
cgtcgggcttatcacaaagagagtgccgagctactagcccaaaagattgatcaggctctc
gctcatggtctgaaggtcatcttctgcgttggcgagcagcaagcagagcgtgagggcaat
cgctacttcgaggtggtcgatgagcagctgcgtggatccttaggacatctctcacacgag
cagatggagcagatagtcatagcttatgagcctgtatgggctatcggcacaggcttgaca
gcaacgccagatcaagcacaggagatgcaccaacatattcgccaaacggtagcatcgctc
tttgaccagaagctagcagatctcaccacaatcctctacggaggtagctgtaaggcttcg
aatgctgagtctctcttctcacagcccgacgtcgatggcggactcatcggaggagctgcc
ctcaaagccgataccttcttacctattatcacagcaaacaaatga

DBGET integrated database retrieval system