KEGG   Porphyromonas asaccharolytica: Poras_1208Help
Entry
Poras_1208        CDS       T01485                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pah00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Poras_1208
Enzymes [BR:pah01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Poras_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545672..1546280
Genome map
AA seq 202 aa AA seqDB search
MIAYLRGTIDTLTPTNAYVDCSGVGYDVNISLSTYDTLHGLERDAPVRLWITEVMRQGEV
CDLYGFYTREEQALFTKLITVSGVGPATARVILSSLAPLELAEVIESGDDKRLKMVKGIG
LKTAQRIIVDLKGKLPETLTDRDDVTAGIGSRAAREVAEEAISALKMLGFAEVNVRKVVK
QIMSVKPDTPVEQVIKQALAKL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatacttacgtggcacgatagatacgctcacaccgaccaacgcctatgtggac
tgtagtggggtgggctacgatgtcaatatatccctctctacttatgacacgctgcatgga
ctggagcgtgatgctcctgtgcgactctggatcacggaggtgatgcgtcaaggcgaggtg
tgtgatctgtacggcttctacacgagggaggagcaggcactctttacaaagctgatcacc
gtctccggtgtgggccccgctacggctcgtgtgatcctctctagtctggccccgctagaa
ctggcggaggtgatcgagagtggcgatgataagcggcttaagatggtcaagggcatcgga
ctcaagacggcgcagcgcatcattgtagatctcaagggcaagctccctgagacactgaca
gatcgtgacgatgtgacggccggtatcggttcgcgggcagctcgtgaggtggctgaggag
gcgatctcagcactcaagatgctgggctttgcggaggtcaatgtgcgcaaggtggtgaag
cagattatgtctgtcaagcccgacacgcctgtagagcaggtgatcaagcaggcgctggcg
aagctctga

DBGET integrated database retrieval system