KEGG   Porphyromonas asaccharolytica: Poras_1277Help
Entry
Poras_1277        CDS       T01485                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Poras_1277
Enzymes [BR:pah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Poras_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1648869..1649435
Genome map
AA seq 188 aa AA seqDB search
MSHLILISAPSGSGKSTVIKQLMQDESLRLSFSISATSRPPRGNEQHGVEYYFYTPEQFK
QLIAEDRLVEYVEVYPGKYYGTLRSEVDRLASMGRNILFDVDAVGAMRIQEAYRDKVVSI
FLMPPTFAELRRRLESRGTESPELVEERMRRASYEINFAEQFDHTVVNDDLKLCVSQVAK
IIRDTISQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatctcatccttatctctgccccctcaggctctggcaagagtaccgtcatcaag
cagctcatgcaagacgagagcctgcgactctccttcagcatatccgccacgagccgtcca
ccacgaggcaatgagcagcatggtgtggagtactacttctacacgcccgagcagttcaag
cagttgatcgccgaggatcgcctcgtagagtatgtggaggtctaccccggcaagtactac
ggcacgcttcgtagcgaggtcgatcggttggctagtatgggacgcaacatcctctttgac
gtagatgccgttggggcgatgcgcatccaagaggcttatagagacaaggtcgtcagcatc
ttcctcatgccacccacctttgcggagctacgtcgccggcttgagtctcgaggcactgag
agccccgagctggtcgaggagcgcatgcgtcgtgcttcgtatgagatcaactttgccgag
cagtttgaccatacggtggtcaacgatgacctcaagctttgcgtctcgcaggtcgcaaag
atcatccgtgacacgatcagccagtaa

DBGET integrated database retrieval system