KEGG   Porphyromonas asaccharolytica: Poras_1363Help
Entry
Poras_1363        CDS       T01485                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pah  Porphyromonas asaccharolytica
Pathway
pah00010  Glycolysis / Gluconeogenesis
pah00260  Glycine, serine and threonine metabolism
pah00680  Methane metabolism
pah01100  Metabolic pathways
pah01110  Biosynthesis of secondary metabolites
pah01120  Microbial metabolism in diverse environments
pah01130  Biosynthesis of antibiotics
pah01200  Carbon metabolism
pah01230  Biosynthesis of amino acids
Module
pah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Poras_1363
  Energy metabolism
   00680 Methane metabolism
    Poras_1363
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Poras_1363
Enzymes [BR:pah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Poras_1363
Membrane trafficking [BR:pah04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Poras_1363
Exosome [BR:pah04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Poras_1363
  Exosomal proteins of melanoma cells
   Poras_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEE13302
UniProt: F4KMK3
Position
complement(1761674..1762420)
Genome map
AA seq 248 aa AA seqDB search
MKRLVLVRHGQSAWNKSNQFTGWTDVDLTEQGVEEAHEAGRRLHKAGFRFGKAYTSYLKR
AIKTLNIILDEMDLDWIPVEKSWRLNEKHYGMLQGLDKSETAAKYGEEQVHIWRRSYDVP
PAPLDPTDERAPQYDPRYAAVNPNELPLTESLKETVERILPYWESNIRPDLEKYGEIIVT
AHGNSLRGIVKHLKGISDEEIPALNLPTGIPYVFEFDDKMQLQRDYFLGDPEQIAKLQAA
VANQGKSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacttgtattagtacgccacggacagagtgcgtggaataagagtaaccaattc
accggctggacagacgttgacctcactgagcaaggtgtcgaggaggcacacgaggctggc
cgacggctacacaaggcgggctttcgctttggcaaggcttacacttcatatctcaagcgc
gccattaagacgctgaatattatcctcgatgagatggacctcgactggatccccgtggag
aaatcctggcgtctcaacgagaagcactacggcatgctacaaggactggacaagtctgag
acagctgctaagtatggcgaggagcaagtgcacatctggcgacgtagctacgacgtgccg
cccgcaccgctagacccgaccgatgagcgtgcccctcagtacgacccacgctatgctgcg
gtcaatcctaacgagctcccactcacggagtcgctcaaggagacagtcgagcgcatcctt
ccttattgggagagcaacattcgtccagatctggagaagtatggcgagatcatcgtcacg
gctcacggcaatagcttgagaggtatcgtcaagcacctcaagggcatctcagacgaagaa
atccctgcgctcaatctgccgacgggcatcccgtacgtcttcgagtttgacgacaagatg
cagctgcagcgtgactacttcctcggtgatcccgagcagatagctaagcttcaggcagct
gttgctaatcagggcaagagcaagtaa

DBGET integrated database retrieval system