KEGG   Porphyromonas asaccharolytica: Poras_1363Help
Entry
Poras_1363        CDS       T01485                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Poras_1363
   01230 Biosynthesis of amino acids
    Poras_1363
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Poras_1363
  Energy metabolism
   00680 Methane metabolism
    Poras_1363
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Poras_1363
Enzymes [BR:pah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Poras_1363
Exosome [BR:pah04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Poras_1363
  Exosomal proteins of melanoma cells
   Poras_1363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1761674..1762420)
Genome map
AA seq 248 aa AA seqDB search
MKRLVLVRHGQSAWNKSNQFTGWTDVDLTEQGVEEAHEAGRRLHKAGFRFGKAYTSYLKR
AIKTLNIILDEMDLDWIPVEKSWRLNEKHYGMLQGLDKSETAAKYGEEQVHIWRRSYDVP
PAPLDPTDERAPQYDPRYAAVNPNELPLTESLKETVERILPYWESNIRPDLEKYGEIIVT
AHGNSLRGIVKHLKGISDEEIPALNLPTGIPYVFEFDDKMQLQRDYFLGDPEQIAKLQAA
VANQGKSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacttgtattagtacgccacggacagagtgcgtggaataagagtaaccaattc
accggctggacagacgttgacctcactgagcaaggtgtcgaggaggcacacgaggctggc
cgacggctacacaaggcgggctttcgctttggcaaggcttacacttcatatctcaagcgc
gccattaagacgctgaatattatcctcgatgagatggacctcgactggatccccgtggag
aaatcctggcgtctcaacgagaagcactacggcatgctacaaggactggacaagtctgag
acagctgctaagtatggcgaggagcaagtgcacatctggcgacgtagctacgacgtgccg
cccgcaccgctagacccgaccgatgagcgtgcccctcagtacgacccacgctatgctgcg
gtcaatcctaacgagctcccactcacggagtcgctcaaggagacagtcgagcgcatcctt
ccttattgggagagcaacattcgtccagatctggagaagtatggcgagatcatcgtcacg
gctcacggcaatagcttgagaggtatcgtcaagcacctcaagggcatctcagacgaagaa
atccctgcgctcaatctgccgacgggcatcccgtacgtcttcgagtttgacgacaagatg
cagctgcagcgtgactacttcctcggtgatcccgagcagatagctaagcttcaggcagct
gttgctaatcagggcaagagcaagtaa

DBGET integrated database retrieval system