KEGG   Porphyromonas asaccharolytica: Poras_1642Help
Entry
Poras_1642        CDS       T01485                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pah  Porphyromonas asaccharolytica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pah00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2089982..2090449
Genome map
AA seq 155 aa AA seqDB search
MPTAYIALGSNLDDPRHQLLEAIRRMRLGGLQVYSIAPFMETRPVGFASEHLFLNSVVAV
HTTATPEELLAQLQAIEREMGRRHKSHDGIYSDRVIDLDILLYDQSVVTTLELTIPHPRM
CERAFVLQPLSDIAPELTIPTTGATVAQLLGALPS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcctactgcttacatagctctcggtagcaacctcgacgatcctcgccaccagctgcta
gaggcgattaggcggatgcgtctcggtggactccaagtctacagcatagccccctttatg
gagactcgccccgtgggcttcgcttcggagcatctcttcctcaatagcgttgtggcggtg
cacacgacagcaacgccagaagagcttctagcacagctccaggctatcgagcgtgagatg
gggcgacggcacaagtcgcacgacggcatctactccgaccgagtcatagacctagacata
ctgctctacgaccagtcggtcgtgaccacacttgagctcacgatcccgcaccctcgtatg
tgtgagcgagccttcgtcttgcagcctctcagcgacatagcgcctgagctcaccatcccc
acgacgggggctaccgtggctcagctactaggagccttgccctcatga

DBGET integrated database retrieval system