KEGG   Pyrobaculum aerophilum: PAE0257Help
Entry
PAE0257           CDS       T00073                                 

Definition
(GenBank) tryptophan synthase beta subunit (trpB), authentic frameshift
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pai  Pyrobaculum aerophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAE0257
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAE0257
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAE0257
Enzymes [BR:pai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAE0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(142112..143281)
Genome map
AA seq 389 aa AA seqDB search
MREVYLIWRPTPLIRAKRLEAALKTPARIYYKFEGVSPPGSHKPNTAVAQLYYISREGVD
RVTTETGAGQWGSSVAFAASLFGVKATVYMVRASYLQKPYRRVLMELWGAEVVPSPSYRT
EAGRKFLAEDPNHPGSLGIAISEAVEDAVRSGAKYVLGSVLNHVLIHQTVIGLEALEQIR
YFNDYPDYVVGACGGGSSFSGLFWPFYYEKKSGRAEKEVKFIAVEPAAVPTLTRGKYTYD
LGDTAGLTPLIKMYTVGHGYKPPPIHAGGLRYHGCAPALSLLVAEGEVGAVAYKQTEVFE
AARLFAATEGVVPAPESAHAVKAAVDLALQAKREGREVTILFNMSGHGLLDLIAYDEYMR
GVLQDVEPSPEEIMAHILKAAELLKTQTP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaggtgtacctcatatggcgcccgacgcctctcatccgggccaagaggcttgag
gcggctttgaaaacccccgctaggatttactacaaattcgagggggtgtccccgcccggt
agccataagcccaacaccgctgtggcacaactctactacatctccagggagggagtcgac
agagtcaccactgagacgggggcaggccagtggggctcctcagtggcctttgccgcctct
ctattcggcgtcaaggcgactgtgtatatggtaagggcctcctatttacaaaagccgtac
cgccgggtgttaatggagttgtggggcgcggaagtcgtgccgagccccagctacagaact
gaggcggggcgcaaattcctcgcggaggatcccaaccacccgggttctctgggcattgcg
atttctgaggccgtggaagacgccgtgaggagcggggcaaaatacgtcttgggctctgtg
ctaaaccacgtcttaatccaccagactgtcatcgggctggaggcattggaacaaattcgg
tattttaacgactacccggactacgtagtgggggcttgcggaggcggtagctctttcagc
ggcctcttctggccgttttactacgagaagaagtccggcagggctgaaaaagaggtgaag
ttcattgccgtggagccggccgccgtccccaccctcacccgcggcaagtatacgtacgac
ctcggcgacaccgcgggcctcacgccgttgataaaaatgtataccgtcggccacggctac
aagcctccgcctatacacgccggaggcttacgctatcacggctgcgccccagctctctcg
ctgttagtggctgagggggaagtaggcgccgttgcatataaacagacggaggtcttcgag
gcggcgagactattcgcggctactgagggcgtcgtcccggcccccgagtccgcccacgcg
gtgaaagccgctgtggatctagcgcttcaagccaagcgggagggcagagaggttacaata
ctcttcaacatgtctggccacggcctcttagacttgatcgcatatgacgagtatatgcga
ggagtcttacaagacgtagagccctctccggaggaaataatggcgcatattttaaaggcg
gcagagcttttaaaaacacagactccctaa

DBGET integrated database retrieval system