KEGG   Pyrobaculum aerophilum: PAE0376Help
Entry
PAE0376           CDS       T00073                                 

Definition
asparagine synthetase (asnB)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pai  Pyrobaculum aerophilum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pai00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213891..214715
Genome map
AA seq 274 aa AA seqDB search
MIELLAKYSDCNAVLFSGGIDSTLVLTAAVKRGLMPLAVHVAMRNCGVDTKYAVSVAAKL
GVPLAVRLMDLEEALGALPKVVKILGLFNPMEVVNCAVVYFGLEKALELGAKRVCTGDGG
DELFLGYSFFQRYSPGELDRVRRRVVSRWYFCSFDLGRSLGVEVVAPFTAQEVVELALSL
SPVEVLGKKPLRDVLRGYFPEVAEREKTPLERGSCFDRLYGEMRQRAGDEVEYLKSLFKE
LGLSYPTSPRGCPRCGYAYFDGSYCRMCGYARGK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattgagttgctggcgaagtactccgactgcaacgccgtgcttttctcaggggggata
gactccacccttgttctgacggcggcagtcaagagggggctgatgcctttggccgtgcac
gtcgctatgaggaattgcggcgtggatactaaatacgcggtgtctgtcgcggcgaagcta
ggcgtcccgctggcggtgaggcttatggatttggaagaggccttgggcgcgttgccaaaa
gtcgttaagattttaggccttttcaaccccatggaggtggttaactgcgccgtggtttac
ttcggcttagaaaaggcattggagctaggcgctaagagagtgtgtactggcgatggcggg
gacgagctcttcctgggctacagcttcttccagaggtatagccccggggaattagacaga
gttaggagacgcgttgtctcccggtggtatttctgtagttttgacctgggcaggtccctg
ggggttgaggtcgtcgcgcctttcacagcacaggaagtggttgagctagccttatcgctc
agccccgtggaagtcctggggaaaaagccccttagggacgtcctaagggggtatttcccc
gaggtggccgaaagggaaaagacgcccctggagagggggtcgtgttttgacagactttac
ggcgagatgagacaaagggcaggagacgaagtggaatacttgaagtcgctgttcaaagaa
ctgggtctgtcataccccacctccccaaggggatgtcccagatgcggctatgcctatttt
gacgggagttattgccgtatgtgcggctatgcacgggggaagtag

DBGET integrated database retrieval system