KEGG   Pyrobaculum aerophilum: PAE0570Help
Entry
PAE0570           CDS       T00073                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pai  Pyrobaculum aerophilum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pai01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pai00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(307026..307775)
Genome map
AA seq 249 aa AA seqDB search
MDFLTEVKRTVELRLATEPPPPARSLPLVDFIKSLGEFGIIAEYKRASPRGVIRLDLPPW
AYFAQVYQYASAFSVLTEPFWFLGDYRFIPIAKAFKPVLMKDFVIDKRQIEAAYGYGADA
VLIIYRLVERERAMELAEYAQRLGLTPVVEIDNVQDAKEVATWGGRLVIGINSRDLKTLE
TNVQRAFEVAKALRGDVEFIIESGLSRPEEVERACSLYARGVLIGTALMKNPVLVKELRQ
VAERCIARR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcctcactgaggtgaagagaacagttgaactccgcctagccacagagcccccg
ccgcctgccagatctctgccattagtagattttataaaatcccttggggaatttggaata
attgccgagtacaaaagggcgtcgccgcggggagttatccgcctcgacctcccgccttgg
gcctacttcgcccaggtataccaatacgcctctgccttttccgtcctcacagagcccttc
tggtttttaggcgactaccgctttattcccatagccaaggccttcaagccagtcttaatg
aaagactttgttatagacaagaggcagatagaggcggcgtatggctacggcgcagacgca
gttctgattatataccgcctcgtggaaagggagagggctatggagctcgccgagtatgcg
caacggctggggctgaccccagtggttgagatcgacaacgtacaagacgccaaagaagtg
gcgacgtggggcgggaggctcgtcatcggcataaactcgcgggatctcaagacgcttgag
actaacgtgcagagggcttttgaagtggctaaggcgctgaggggagacgtcgagtttata
attgaaagcgggctttcacggccggaggaagtggaaagggcgtgctctctatacgctagg
ggcgttttaataggcactgcgctgatgaaaaacccggtgttagtaaaagagcttagacaa
gtggccgagaggtgcatagccaggcgttga

DBGET integrated database retrieval system