KEGG   Pyrobaculum aerophilum: PAE0570Help
Entry
PAE0570           CDS       T00073                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01130  Biosynthesis of antibiotics
pai01230  Biosynthesis of amino acids
Module
pai_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAE0570
Enzymes [BR:pai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PAE0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh Ferritin
Motif
Other DBs
NCBI-ProteinID: AAL62870
UniProt: Q8ZYX2
Position
complement(307026..307775)
Genome map
AA seq 249 aa AA seqDB search
MDFLTEVKRTVELRLATEPPPPARSLPLVDFIKSLGEFGIIAEYKRASPRGVIRLDLPPW
AYFAQVYQYASAFSVLTEPFWFLGDYRFIPIAKAFKPVLMKDFVIDKRQIEAAYGYGADA
VLIIYRLVERERAMELAEYAQRLGLTPVVEIDNVQDAKEVATWGGRLVIGINSRDLKTLE
TNVQRAFEVAKALRGDVEFIIESGLSRPEEVERACSLYARGVLIGTALMKNPVLVKELRQ
VAERCIARR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggacttcctcactgaggtgaagagaacagttgaactccgcctagccacagagcccccg
ccgcctgccagatctctgccattagtagattttataaaatcccttggggaatttggaata
attgccgagtacaaaagggcgtcgccgcggggagttatccgcctcgacctcccgccttgg
gcctacttcgcccaggtataccaatacgcctctgccttttccgtcctcacagagcccttc
tggtttttaggcgactaccgctttattcccatagccaaggccttcaagccagtcttaatg
aaagactttgttatagacaagaggcagatagaggcggcgtatggctacggcgcagacgca
gttctgattatataccgcctcgtggaaagggagagggctatggagctcgccgagtatgcg
caacggctggggctgaccccagtggttgagatcgacaacgtacaagacgccaaagaagtg
gcgacgtggggcgggaggctcgtcatcggcataaactcgcgggatctcaagacgcttgag
actaacgtgcagagggcttttgaagtggctaaggcgctgaggggagacgtcgagtttata
attgaaagcgggctttcacggccggaggaagtggaaagggcgtgctctctatacgctagg
ggcgttttaataggcactgcgctgatgaaaaacccggtgttagtaaaagagcttagacaa
gtggccgagaggtgcatagccaggcgttga

DBGET integrated database retrieval system